KEGG   Mycobacterium vaccae: MYVA_5470Help
Entry
MYVA_5470         CDS       T04356                                 

Gene name
ligC2
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mvq  Mycobacterium vaccae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
5695013..5696113
Genome map
AA seq 366 aa AA seqDB search
MGAMKLPVMPPVPPMLSRPVAGFPQGPAALSYEPKWDGFRSILFRDGDEVELGSRNERPM
TRYFPELVEAARVELPDRCVVDGEIVIATGDGLDFEALQLRLHPAASRVQMLAGQTPAAF
IVFDLLALGDTDYTGQPFSERRAALVEALAGTGPTFHVTPATTDVDTAQRWFDEFEGAGL
DGIVAKPLDGRYLPDKRTMFKIKHQRTADCVVAGYRLHKSGPDAVGSLLLGLYDGDGSLA
SVGVIGAFPMARRRELFTELQPLVTTFDNHPWNWAAYAAANPEARAYGGGSRWNAGKDLS
FVPLRPERVVEVRYDHMEGQRFRHTAQFNRWRPDRDPRSCTYDQLDRPVTFRLDDIVPGL
IQQGES
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgatgaagctacccgtgatgccgccggtgcctccgatgctgtcgcggcccgtc
gctgggtttcctcagggccccgcggcgctgtcctatgaacccaaatgggacgggttccgc
tcgatcctgttccgcgacggcgacgaggtcgagctgggcagccgcaacgaacggccgatg
acgcggtactttccggaactcgtcgaggcagcgcgcgtcgaactaccggaccgctgcgtc
gtcgacggcgagatcgtcatcgcgaccggggacgggctcgatttcgaggcgctgcagctg
cgactgcacccggccgcgtcgcgcgtgcagatgctcgccgggcagacacctgcggcattc
atcgtgttcgatctgctcgcgctcggcgacaccgactacacgggtcagccgttctcggag
cgtcgcgccgcgctggtcgaggcgctcgcgggaaccggcccgacgttccacgtgacaccg
gcaacgaccgatgtcgacaccgcgcaacgctggttcgacgagttcgagggcgcgggactc
gacggcatcgtcgccaagccgctggacgggcggtacctgccggacaagcggacgatgttc
aagatcaagcaccagcgcacggccgactgtgtggtcgctggataccggctgcacaagtcc
gggcccgacgcggtcggctcgctgttgctcggcctctacgacggcgacggatcactggcc
tccgtcggagtcatcggcgcgttcccgatggcacgtcgccgtgagcttttcaccgaactg
caaccgttggtcaccaccttcgacaatcacccgtggaactgggcggcctacgcggcagcc
aatccggaggcacgtgcctacggcggcggctcgcggtggaacgcgggcaaggatctgtcg
ttcgtgccgcttcggccggagcgggtggtcgaggtgcgctacgaccacatggaaggccaa
aggtttcgtcacacagcgcaattcaatcgctggcgaccggatcgcgacccacgctcgtgc
acgtacgaccagttggaccggccggtgacgttccgtcttgacgacatcgtgcccggcctc
atccagcaaggcgaaagctag

DBGET integrated database retrieval system