KEGG   Myxococcus xanthus: MXAN_3581Help
Entry
MXAN_3581         CDS       T00366                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mxa  Myxococcus xanthus
Brite
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     MXAN_3581
Peptidases [BR:mxa01002]
 Metallo Peptidases
  Family M2
   MXAN_3581
Exosome [BR:mxa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MXAN_3581
CD molecules [BR:mxa04090]
 Proteins
  MXAN_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4176810..4178684
Genome map
AA seq 624 aa AA seqDB search
MNRKRPLNSLLRAAAVMVLPAFLGCAQDSQVTREAPTPAESPAAASQPSPAEAKAFAEKV
NADLKSLWTKQATAEWIKSTYITDDTEQNAAFVNEEVLAYVNGAIKEARRFEGLTLDADT
ARMLHLLKVSQALPAPSDAERRSELAATAAKLEGLYGKGKYCGPDGKGKCRDLEVLSDVI
AESRNFDELLDAWQGWHSVARPMRPLYERLVSISNEGAKDIGFNDLGTLWRSAYDMSPGE
FEVEAQRLWGQVKPLYDDLHCYVRGRLAKQYGADKVPDGKPIPAHLLGNMWAQEWNNIYP
LVEPFPGQASLDVDAALKQQKYDAMRMVKLGEKFFTSLGLKELPPSFFERSQFTKPEGRD
VVCHASAWDVNFSNDLRIKMCIKPTEEDLVTIHHELGHNYYYTYYYQLPVLYQAGANDGF
HEAIGDALTLSITPGYLQQAGLLKAVPKNEKNLINLQMKDALEKIAFLPFGLLVDQWRWE
VFSGRVQPADYNKSWWTLREKYQGVAAPVARSEQDFDPGAKYHVPANVPYTRYFLARILQ
FQFHKALCEASGYKGALHECSIYGNKDAGKRLQAMLELGASKPWPDALQAMTGTRQMDAT
PLLDYFSPLRTWLQAQNKGQKCGW
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaacgtcccctgaattccctcctgcgtgcggccgcggtcatggtgctgccc
gccttcctggggtgtgcccaggattcgcaagtgacacgcgaggcgcccacgcccgccgag
tctcccgccgccgcgtcgcagccctcgccggcagaggcgaaggccttcgcggagaaggtg
aacgcggacctcaagagcctgtggacgaagcaagccaccgcggagtggatcaagtccacg
tacatcaccgatgacaccgagcagaacgccgccttcgtcaacgaagaggtgctggcctac
gtcaacggcgccatcaaggaggcgcggcgcttcgagggcctgacgttggacgcggacacc
gcgcgcatgctgcacctgctcaaggtgtcccaggcgctgccggcgccgtcggacgcggag
cggcggtccgagctggccgccacggcggcgaagctggagggcctctacggcaagggcaag
tactgcgggccggacgggaaggggaagtgccgcgacctggaggtgctgtccgacgtcatc
gcggagagccgcaactttgacgaactgctggacgcgtggcagggctggcactccgtggcc
cgtcccatgcggccgctgtacgagcgcctggtgtccatctccaacgagggcgcgaaggac
atcggcttcaacgacctgggcacgctctggcgctccgcgtatgacatgtcgccgggcgag
ttcgaggtcgaggcccagcgcctgtggggccaggtgaagccgctctatgacgacctgcac
tgctacgtgcgcggccgtctggcgaagcagtacggcgccgacaaggtacccgacggcaag
ccgattcccgcgcacctgctgggcaacatgtgggcgcaggagtggaacaacatctacccg
ctggtggagcccttccccggacaggccagcctggacgtggacgcggcgctgaagcagcag
aagtatgacgcgatgcgcatggtgaagctgggtgagaagttcttcacctcgctgggtctc
aaggagctgccgccgagcttcttcgagcgctcgcagttcaccaagccggaaggccgcgac
gtcgtctgccacgccagcgcctgggacgtgaacttcagcaacgacctgcgcatcaagatg
tgcatcaagcccacggaggaggacctcgtcaccatccaccacgagctgggccacaactac
tactacacgtactactaccagctcccggtgctctatcaggccggcgcgaacgacggcttc
cacgaggccattggtgacgcgctcacgctgtccatcaccccgggctacctgcagcaggcg
gggttgctgaaggccgttccgaagaacgagaagaacctcatcaaccttcagatgaaggac
gcgctggagaagattgccttcctgccgttcggtctgctcgtggaccagtggcgctgggag
gtgttctccggccgcgtgcagccggcggactacaacaagtcctggtggacgctgcgggag
aagtaccagggcgtcgccgcgccggtggcccgttcggagcaggacttcgacccgggggcc
aagtaccacgtgcctgcaaacgttccgtatacgcggtatttcctggcgcgcatcctccag
ttccagttccacaaggcgctctgcgaggcgtctggctacaagggcgccctccacgagtgc
tccatctatgggaacaaggatgccggcaagcggctccaggccatgttggagctgggtgcg
agcaagccgtggcccgacgcgctccaggccatgacgggaacccggcagatggatgccacg
ccgctgctcgactacttcagcccgctccgcacctggctccaggcgcagaacaagggccag
aagtgcggttggtga

DBGET integrated database retrieval system