KEGG   Myxococcus xanthus: MXAN_3684Help
Entry
MXAN_3684         CDS       T00366                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00500  Starch and sucrose metabolism
mxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MXAN_3684 (treS)
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MXAN_3684 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MXAN_3684 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 GHL5
Motif
Other DBs
NCBI-ProteinID: ABF88853
UniProt: Q1D652
LinkDB All DBs
Position
complement(4396077..4397732)
Genome map
AA seq 551 aa AA seqDB search
MDLDPLWYKKALIYELHLRAFHDSNGDGHGDIPGLIEKLPYLQDLGINCLWLLPHYPSPL
RDDGYDIADFYGVHPDYGTLADFQRLVDEAHKRDIRVITELVVNHTSDQHPWFQEARSDP
NSPKRNWYVWSDTDEQYKGARIIFLDTERSNWTWDPVAKQYFWHRFFSHQPDLNYDNPEV
QEAMLDVMRFWLNMGVDGFRCDAVPYLFEREGTNCENLPETHAFLKRLRKTIDSEYKGKM
LLAEANQWPADVRVYFGDGDEFHMGFHFPVMPRLYMAVRREDRTPIVEIMQQTPDIPDNC
QWAIFLRNHDELTLEMVTDEDRDYMYREYATDPRMRINLGIRRRLAPLMDNGRRRIELMH
SLLFTLPGTPVLYYGDEIGMGDNIYLGDRNGVRTPMQWTGDRNAGFSRADYARLYAPVIA
DPVYGYQSINVEAQERVKSSLLHWVKRMIRIRQRYPVFSLGNLRFLQTDNRKVLAFIREW
EGQTVLVVCNLSRFAQPAVLDMREWEGAVPVELIGETPFPRVSELPYQLSMGPFMFLWFR
LDRPQQVRSLE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacctggatcccctctggtacaagaaagcccttatctacgagctgcacctgcgtgcc
ttccatgactccaatggcgacggccacggggacatccccggtctgattgagaagcttccg
tacctccaggacctgggcatcaactgcctctggttgctgccccactacccttcgccgctg
cgcgacgatggctacgacatcgcggacttctacggcgtccacccggactacggcacgctc
gcggacttccagcgactggtggatgaggcgcacaagcgcgacatccgcgtcatcaccgag
ctggtggtgaaccacaccagtgaccagcacccctggttccaggaagcgcgcagcgacccc
aacagccccaagcgcaactggtacgtctggagcgacaccgacgaacagtacaagggcgcg
cgcatcatcttcctggacacggagcgctccaactggacgtgggacccggtggccaagcag
tacttctggcaccgcttcttcagccaccagccggacctcaactacgacaaccccgaagtg
caggaagccatgctggacgtcatgcgcttctggctcaacatgggcgtggacgggttccgc
tgcgacgcagtgccctacctcttcgagcgcgaaggcaccaactgcgagaaccttccggag
acgcacgccttcctcaagcgcctgcggaagaccatcgactccgaatacaaggggaagatg
ctgctggcggaggcgaaccagtggcccgccgacgtgcgcgtgtacttcggcgacggcgac
gagttccacatgggcttccacttcccggtgatgccccgcctctacatggcggtgcgccgc
gaggaccgcacgcccatcgtcgaaatcatgcagcagacgccggacatcccggacaactgc
cagtgggccatcttcctgcgcaaccatgacgagctgacgctggagatggtgacggacgag
gaccgggactacatgtaccgggaatacgccaccgacccgcgcatgcgcatcaacctgggc
atccgccgccggctggcgccgctgatggacaacggccgccggcgcatcgagctgatgcac
agcctgctcttcaccctgcccggcacgcccgtcctctattacggcgacgagattggcatg
ggcgacaacatctacctcggcgaccgcaacggcgtgcgcacgcccatgcaatggacggga
gaccgcaacgcgggcttcagccgcgcggactacgcacgcctgtacgcgcccgtcatcgcc
gacccggtgtacggttatcagtccatcaacgtggaagcgcaggagcgggtgaagtccagc
ctcctgcactgggtgaagcggatgattcgcatccgccagcgctaccctgtcttctcgctg
gggaacctgcgcttcctccagacggacaatcgcaaggtgctggccttcatccgtgaatgg
gagggccagacggttctggtggtgtgcaacctgtcgcgctttgcccagcccgcggtgctc
gacatgcgcgagtgggaaggcgccgtgccggtggagctgattggagaaacccccttcccg
cgggtgagtgagctgccgtatcagctctccatgggccccttcatgtttctgtggttccgg
ctggacaggccccagcaggtgaggagcctcgaatga

DBGET integrated database retrieval system