KEGG   Myxococcus xanthus: MXAN_4097Help
Entry
MXAN_4097         CDS       T00366                                 

Definition
(GenBank) D-alanine-D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00473  D-Alanine metabolism
mxa00550  Peptidoglycan biosynthesis
mxa01100  Metabolic pathways
mxa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MXAN_4097
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MXAN_4097
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MXAN_4097
Enzymes [BR:mxa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MXAN_4097
Peptidoglycan biosynthesis and degradation proteins [BR:mxa01011]
 Precursor biosynthesis
  Amino acid ligase
   MXAN_4097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A ATP-grasp ATPgrasp_Ter TTL ATPgrasp_YheCD Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: ABF86075
UniProt: Q1D4Z8
LinkDB All DBs
Position
complement(5041602..5043791)
Genome map
AA seq 729 aa AA seqDB search
MRIALTHNLRLSDLEEEAEFDTQETVNALAAAIERIGHRLERFEVSGPASRTVARLEAYS
PDLIFNTAEGRRGRFREAFYPALFDELGFPYTGSDAYALAVTLDKQLTKLVLSKQGIRTP
GWQYVEKLSELSAENLRFPVIVKPNFEGSSKGISQDSIAETLDEVRAKVAAALEKYPSGV
LVEEYISGRDLAVPFLESVDNDYDGVLSPVEYVIDPAVTQGRKYAIYDYALKTSREGTVS
VRAPAQIPPRTAEDVRRMAQKVYRALDCRDLGRIDVRLSDAGVPYFLEINALPSLEPGAG
IYAAAELDGLHLDGVINSIITSAAKRYKIKDSSRRQGKPARKSGPLRVGFSFNVKRVKPT
ATAEAVEDSEAEYDSPNTLQAIREAIASWGHEVIDLEATAELPSVLSSTPLDVVFNIAEG
FKGRNRESQVPALLELLDIPYTGSDPATLSIALDKGLAKKIVRQAGILTPNFQLMATGKE
RLNKEFTSFPLIVKPVAEGSSKGVVTKSVCHSEAELREVVREIAGKYQQPALIEEYIRGR
EFTVGLLGERRPRVLPPMEIVFLDREEKNPVYSFQHKLDWTDRIRYDAPAKLEPALLERL
RTAARNSFMALGCRDVARIDFRMDDKGRIYFIECNPLPGLTPGWSDLVLIAQGAGMDYRG
LIGEIMAPAIPRYKEREARRAASEHPASVLRKSVPLEEGTPAAAQPVAATAPAPASPAPE
PSPRMDAKA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcgctgacccacaacctcaggctgtctgatttggaagaagaggcggagttc
gacacgcaggagacggtcaacgcgctcgcggcggccatcgagcgcatcggccaccggctg
gagcgcttcgaggtgagcggcccggcctcgcgcaccgtggcgcggctggaggcctacagc
ccggacctcatcttcaacaccgccgagggccgccgcggccgcttccgcgaggccttctat
ccggccctcttcgacgagctgggcttcccgtacacgggctcggacgcgtacgcgctggcg
gtgacgctcgacaagcagctcaccaagctggtgctgtccaagcagggcatccgcacgccc
ggctggcagtacgtggagaagctcagcgagctgtccgcggagaacctgcgcttccctgtc
atcgtgaagcccaacttcgagggctcgtccaagggcatcagccaggactccatcgcggag
acgctggacgaggttcgcgccaaggtggccgccgcgctggagaagtacccgtccggcgtg
ctggtggaggagtacatctccggccgcgacctcgccgtgccgttcctggagtcggtggac
aatgactacgacggcgtgctctccccggtggagtacgtcatcgacccggccgtcacgcag
ggccgcaagtacgccatctacgactatgcgctgaagacgtcgcgggagggcacggtcagc
gtgcgcgcccctgcgcagattccgcctcgcacggcggaggacgtccggcggatggcgcaa
aaggtgtaccgggcgctcgactgccgcgacctgggccgcatcgacgtgcgcctcagtgac
gccggcgtgccgtacttcctggagatcaacgcgctccccagcctggagccgggcgcgggc
atctacgcggcggcggagctggacggcctgcacctggatggggtcatcaactccatcatc
accagcgcggcgaagcggtacaaaatcaaggactcgtcgcgtcgccagggcaagccagcg
cgcaagagcggtccgctgcgcgtgggcttcagcttcaacgtgaagcgcgtgaagcccacg
gccacggcggaggcggtggaggacagcgaggccgagtacgactcgccgaacacgctccag
gccatccgcgaggcgattgcgtcgtggggccacgaggtcatcgacctggaggccacggcc
gagcttccctcggtgctgtcgagcacgccgctggacgtggtgttcaacatcgcggagggc
ttcaagggccgcaaccgagagagccaggtcccggcgctgctggagctgctggacatcccg
tacacgggctcggacccggccacgctgtccatcgccctggacaagggcctggcgaagaag
attgtccggcaggctggcatcctcacgcccaacttccagctcatggcgacgggcaaggag
cgcctcaacaaggagttcaccagcttcccgctcatcgtgaagccggtggcggagggcagc
tccaagggcgtcgtcaccaagagcgtctgccacagcgaggcggagctgcgcgaggtggtg
cgcgagattgccggcaagtaccagcagcccgcgctcatcgaggagtacatccgcggccgt
gagttcaccgtgggcctgctgggcgagcggcgtccccgcgtcctgccgcccatggagatc
gtcttcctggaccgggaggagaagaaccccgtctacagcttccagcacaagctcgattgg
acggaccgcatccgctacgacgcgccggcgaagctggagcccgcgctgctggagcggctg
cgcacggcggcgcgcaactcgttcatggcgctgggatgccgcgacgtcgcgcgcatcgac
ttccgcatggatgacaaggggcgcatctacttcatcgagtgcaacccgctgccgggcctg
acgccgggctggagcgacctggtgctcatcgcccagggcgccggcatggactaccggggg
ctcatcggcgaaatcatggcccccgccatcccccgctacaaggagcgcgaggcgcgccgc
gccgccagcgagcaccccgcttcggtgttgcgcaagagcgtgcccctggaggaggggact
cccgccgccgcgcagcccgtggccgcgacggcccccgcaccggcatccccagcgccggag
ccgtctccgcgcatggacgcgaaggcctga

DBGET integrated database retrieval system