KEGG   Myxococcus hansupus: A176_003327Help
Entry
A176_003327       CDS       T04077                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mym  Myxococcus hansupus
Brite
Enzymes [BR:mym01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     A176_003327
Peptidases [BR:mym01002]
 Metallo Peptidases
  Family M2
   A176_003327
Exosome [BR:mym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A176_003327
CD molecules [BR:mym04090]
 Proteins
  A176_003327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4239583..4241472)
Genome map
AA seq 629 aa AA seqDB search
MNRKHPLNSLLRTAAVAVALPAFLGCAQDSQATREAPPAAESQASTSAAASQPTPEEAKA
FAEKINADLKALWTKQATAEWIKSTYITDDTERNAAYVNEEVLAYVNGAIKEARRFDGLT
LDADTARMLHLLKVSQALPAPSDAQKRSELAATAAKLEGLYGKGKYCGPDGKGKCRDLEV
LSDVIAESRNYNELLDAWQGWHSVARPMRPLYERLVSISNEGAKDIGFNDLGTLWRSAYD
MPPAEFEVEAQRLWGQVKPLYDDLHCYVRGRLAKQYGADKVPEGKPIPAHLLGNMWAQEW
NNIYPLVEPFPGQASLDVDAALKQQKYDAMRMVKLGEKFFTSLGLKELPQTFFERSQFTK
PEGRDVVCHASAWDVNFDNDLRIKMCIKPTEEDLVTIHHELGHNYYYTYYYQLPVLYQAG
ANDGFHEAIGDALTLSITPSYLQQAGLLKAVPKNEKNLINLQMKDALEKIAFLPFGLLVD
QWRWEVFSGRVQPADYNKSWWTLREKYQGVGAPVARSEQDFDPGAKYHVPANVPYTRYFL
ARILQFQFHKALCEASGYKGALHECSIYGNKEAGKRLQAMLELGASKPWPDALQAMTGTR
QMDATPLLDYFSPLRTWLQAQNKGQKCGW
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaacatcccctgaattccctcctgcgcacggccgccgtggccgtcgcgctg
cccgccttcctggggtgtgcccaggactcccaggcgacgcgcgaggcgccccccgcggcc
gagtcccaggcctccacgagcgccgccgcgtcccagcccacgcccgaagaggcgaaggcg
ttcgcggagaagatcaacgcggacttgaaggccctgtggacgaagcaggccaccgcggag
tggatcaaatccacgtacatcaccgacgacaccgagcggaacgcggcgtacgtcaacgaa
gaggtgctggcctacgtcaacggcgccatcaaggaggcgcgccgcttcgacggcctgacg
ctggacgcggacaccgcgcgcatgctgcacctgctcaaggtgtcgcaggcgctgcccgcg
ccgtcggacgcgcagaagcggtccgagctggccgcgacggcggcgaagctggaaggcctc
tacggcaagggcaagtactgcggtccggacgggaaggggaagtgccgcgacctcgaggtg
ctgtccgacgtcatcgcggagagccgcaactacaacgagctgctcgacgcatggcagggc
tggcactcggtggcccgtcccatgcgtccgctgtacgagcgcctggtgtccatctcgaac
gagggcgccaaggacattggcttcaacgacctgggcacgctgtggcgctccgcgtacgac
atgccgcccgcggagttcgaggtcgaggcccagcgcctgtggggccaggtgaagccgctc
tatgacgacctgcactgctacgtgcgtggccggttggcgaagcagtacggcgccgacaag
gtccccgagggcaagcccattcccgcgcacctgctcggcaacatgtgggcgcaggagtgg
aacaacatctacccgctggtggagcccttcccggggcaggccagcctggacgtggacgcg
gcgctgaagcagcagaagtacgacgcgatgcggatggtgaagctgggtgagaagttcttc
acctcgctggggctcaaggagttgccgcagaccttcttcgagcgctcgcagttcaccaag
ccggaaggccgtgacgtcgtgtgtcacgccagcgcgtgggacgtgaacttcgacaacgac
ctgcgcatcaagatgtgcatcaagcccaccgaggaggacctggtcaccatccaccacgag
ctgggccacaactactactacacgtactactaccagctcccggtgctctatcaggccggc
gccaacgacggcttccacgaggccattggcgacgcgctcacgctgtccatcaccccgagc
tacctccagcaggccggtttgctgaaggcggttccgaagaacgagaagaacctcatcaac
ctccagatgaaggacgcgctggagaagattgccttcctgccgttcggtctgctcgtggac
cagtggcgctgggaggtgttctccggccgggtgcagccggcggactacaacaagtcctgg
tggacgctgcgggagaagtaccagggcgtgggcgcgccggtggcgcggtccgagcaggac
ttcgacccgggtgcgaagtaccacgtgcccgcaaacgttccgtatacgcgttatttcctg
gcgcgaatcctccagttccagttccacaaggcgctctgtgaggcgtctggttacaagggc
gccctccacgagtgctccatctatgggaacaaggaggccggcaagcggctccaggccatg
ttggagttgggcgcgagcaagccgtggcccgacgccctccaggccatgacggggacccgg
cagatggacgccacgccgctgctcgactacttcagcccgctgcgcacctggctccaggcc
cagaacaagggccagaagtgtggttggtaa

DBGET integrated database retrieval system