KEGG   Mycobacterium sp. VKM Ac-1817D: G155_11525Help
Entry
G155_11525        CDS       T03634                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00473  D-Alanine metabolism
myv00550  Peptidoglycan biosynthesis
myv01100  Metabolic pathways
myv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:myv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    G155_11525
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G155_11525
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    G155_11525
Enzymes [BR:myv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     G155_11525
Peptidoglycan biosynthesis and degradation proteins [BR:myv01011]
 Precursor biosynthesis
  Amino acid ligase
   G155_11525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIY46096
UniProt: A0A0A1FNK0
LinkDB All DBs
Position
2392763..2393884
Genome map
AA seq 373 aa AA seqDB search
MTARNGTGSRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERYEVVAVGITPDGSWMLTD
GSPETLAITDGRLPEVTETSGTELALPAAPNRSGQLLALSNGPGELLAAVDVVFPVLHGP
YGEDGTIQGLLELAGIPYVGSGVLSSAAGMDKEFTKKLLVAEGLPIGDFVVLRPNRPTMD
LEQRERLGLPVFVKPARGGSSIGVSRVSAWDELPAAIELARRHDPKVIVEAAIPGRELEC
GVLEFPDGRVEASTLGEIRVAGVRGREDGFYDFATKYLVDAAELDVPAKVDDDVSEEIRR
LAVRAFTAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMFPRMWAASGVDYPTLLTA
MVETALARGTGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcccgcaatgggaccggatcccgcacccgcgtcgccgtcgtctacggcgggcgt
agctctgagcacgctatttcctgcgtatcggcaggcagcatcctgcgcaacctcgacccg
gagcggtacgaggtcgtggccgtcgggatcacccccgacggctcctggatgctgaccgac
ggaagccccgagacgctcgccatcaccgacggccggctgccggaggtcaccgagacgtcc
ggcaccgagctcgcgctgcctgccgccccgaaccgcagcggccagctgctggcgctgagc
aacggtcccggtgagcttttggcggccgtggacgtggtcttcccggtgttgcacggccct
tacggcgaggacgggaccatccaggggctgctggagctggccggtatcccgtacgtgggc
tccggcgtgctgtccagcgccgcaggtatggacaaggagttcaccaagaagctgcttgtc
gccgagggcctgccgatcggtgatttcgtggtgctgcgccccaaccgtccgacgatggat
ctggagcagcgcgaacgcctcggcctgccggtgttcgtcaaaccggcccggggtggctcg
tcgatcggcgtcagccgggtctcggcgtgggatgaactgcctgccgcaatcgaacttgcg
cgtcgccatgacccgaaggtcatcgtcgaggcagcgattcccggtcgggaattggagtgc
ggcgtactcgaattcccggacggtcgggtcgaggccagcactctgggcgagatcagggtg
gcaggcgtgcgcgggcgtgaggacggcttctacgacttcgccaccaaatacctcgtcgac
gcagccgaattggacgtgccggccaaggtcgacgacgacgtgtcggaggagatccgccgg
ttggcggtgcgtgccttcactgcgatcgactgccaggggttggcccgtgtcgacttcttc
ctgaccgacgacgggccggtgatcaacgagatcaacacgatgcccgggttcaccaccatc
tcgatgttcccccggatgtgggcggccagcggcgtcgactacccgacattgctgaccgcg
atggtcgagaccgcgctggcgcggggtaccgggctgcgctga

DBGET integrated database retrieval system