KEGG   Methylobacterium zatmanii: B2G69_23220Help
Entry
B2G69_23220       CDS       T04981                                 

Definition
(GenBank) thiol:disulfide oxidoreductase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
mza  Methylobacterium zatmanii
Brite
Enzymes [BR:mza01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     B2G69_23220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5022688..5023395)
Genome map
AA seq 235 aa AA seqDB search
MIDLHYWPTPNGHKVTMFLEEAGLPYTIHPVDIGKGAQFEPAFLKIAPNNRMPAIVDHEP
ADGGAPVSLFESGAILLYLAEKTGRFLPADLGGRAETLQWLFWQMGGLGPMLGQNHHFSQ
YAPEKIPYAIDRYVKETNRLYGVLDRRLADRAFVAGPDYTIADMASYPWIVPWEKQGQRL
DDHPNLKRWFEAIAERPATKAAYARAVEANPNHGQPMSEDAKKVMFGQTATNTKR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgcattactggccgaccccgaacggtcacaaggtgacgatgtttctggag
gaggccggcctcccctacacgatccacccggtggatatcggcaagggtgcgcagttcgag
ccggccttcctgaagatcgccccgaacaaccggatgccggccatcgtcgatcacgagccg
gccgatggcggtgcgccggtctcgctgttcgagtcgggcgcgatcctgctctacctcgcg
gagaagaccgggcgcttcctgcccgccgacctgggcggccgggccgagaccctgcaatgg
ctgttctggcagatgggcggcctcgggccgatgctgggccagaaccaccatttctcgcaa
tacgcgccggagaagatcccctacgccatcgaccgctacgtcaaggagacgaaccggctc
tacggcgtgctcgaccggcggctcgccgaccgcgccttcgttgcgggccccgactacacc
atcgccgacatggcttcctatccctggatcgtgccgtgggagaagcagggccagcgcctc
gacgaccaccccaacctgaagcgctggttcgaggcgatcgccgagcgccccgccaccaag
gccgcctatgcgcgggcggtggaagccaacccgaaccacggccagccgatgagcgaggac
gcgaagaaggtgatgttcggccagaccgcgacgaacaccaagcgctga

DBGET integrated database retrieval system