KEGG   Maylandia zebra (zebra mbuna): 101470840Help
Entry
101470840         CDS       T02814                                 

Gene name
ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101470840 (ace)
Peptidases [BR:mze01002]
 Metallo Peptidases
  Family M2
   101470840 (ace)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101470840 (ace)
CD molecules [BR:mze04090]
 Proteins
  101470840 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1287 aa AA seqDB search
MGTGLDRFLWSVLLLLPVFGQSEALPESWLPGEYSDTISDAQRFLSDYNSTAEEVFFHSV
SASWNYNTNITDHNSKLQVSASLEEQAFVEAWGIKAKQVFSSGVLDTLPDPKDKKLMEKI
MLLGAANLLPKEREEYNTILSTMDNIYSTSKVHPQPNISWSLEPELTKIMANSRSYKTLL
YAWEGWHNASGVPLKQYYPSFVGLSNKASRADGFQDTGDDWRSWYETETFRQDLEEIYKT
IEPLYLNLHAFVRRQLYNQYGPKYINLKGPIPAHLLGNMWAQTWNNIYDMMIPFPDKPNI
DVTDEMVRQGYNATHMFRVAEEFFTSLGLERMPEEFWEGSMLVKPQGREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDKPMGFRSGANPGFHEAIGDVLSLS
VSTPKHLETINLLESVTSDIETDTNYLLKMALEKIAFLPFGYLIDLWRWDVFSGKTPPER
YNADWWYLRTKYQGICPPTRRTEEHFDAGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEA
AKHTGPLHTCDIYRSAEAGAILKKVLQAGSSESWPVVLQDAIGTNKLNASSLMKYFEPII
EWLNKQNVNETLGWPDFNWVPPMPEGYPEDIDKNTDELDAQKLLEEYNSTAEVVWNAYTE
ASWKYNTDINEANKQAMLEKNLEMSAHTLKYGLQARQYDTTDFQDGSVKRIIKKLSDIER
AALPSAELEEYNTLLSNMETKYSVAEVCRENNECLPLDPDLQKIMAESRDYDELLFAWKG
WRDAAGKVLRQDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEEDLETLWKELEPLY
LNLHAYVRRGLYNKYGSNYINLKGPIPAHLLGNMWAQTWSGIMDLVIPYPDATQVDATPA
MVQQGWDAIRMFQESDKFFTSLGLEPMPPEFWNKSMLEKPSDGRQVVCHASAWDFYNRKD
FRIKQCTVVTMDDLITVHHEMGHIQYFLQYKNQPVSFRDGANPGFHEAIGDVLALSVSTP
KHLQSIGLLDKVENNYESDINFLMSIALDKIAFLPFGYLMDQWRWKVFDGRIPHTEYNKE
WWNLRLKYQGLCPPVTRTEEDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCNAAKHN
GPLYTCDIYQSKEAGKLLGDVMKLGFSKPWPEAMAMITGESKMSAQPLMEYFQPLIEWLE
KENSKNNDVRGWPDYDWKPFSESPTGEAKTVDFLGLNVNRSAATVGQWILLALGMLLLVV
TILMAYMYRKARKPEKSLSTMELKQKD
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgggtactggtttggacaggtttctgtggtcagtactgctgctgctgccagtctttggg
caatctgaggctctgccagaaagctggctgcctggggaatattcagacaccatcagtgat
gcacaaaggttcctcagtgactacaacagcaccgccgaggaggtgtttttccacagtgtc
tctgccagctggaactacaacaccaacataacagaccacaactcaaagcttcaggtaagt
gcatctcttgaagaacaggcattcgtggaggcatgggggatcaaggctaagcaggtcttc
tcttctggagttctcgacacccttcctgaccctaaagacaaaaaattgatggaaaagatc
atgctactcggtgctgccaaccttctcccgaaagaaagagaggagtataacaccattctg
agcaccatggacaatatttattcgacatctaaggtgcacccacagccaaacatcagctgg
agtctggaacctgagctcacaaagatcatggctaactccaggagctacaagacgctgctg
tatgcctgggagggctggcacaatgcgtcaggcgtgccactcaaacagtactatccaagc
tttgtggggctcagcaacaaagcctcgcgagctgatggatttcaggacactggagatgac
tggcgctcttggtatgagactgaaacttttaggcaggacttggaagaaatctacaagacc
attgagccgctctacctgaatctgcacgcctttgtgcgccgccagctctacaaccagtat
ggccccaaatacatcaaccttaaaggacctatccctgctcacttgctaggaaatatgtgg
gcccagacctggaacaacatttatgatatgatgatcccatttcctgacaaacctaacatt
gatgtgactgatgaaatggtcagacaaggctataacgccacacacatgtttcgtgtggcc
gaggagttcttcacctctctgggtttggagaggatgcctgaggagttctgggagggatcc
atgctggttaagcctcagggtcgagaggtggtgtgccacgcgtctgcctgggacttttac
aatcgcaaggacttcagaattaagcagtgcaccacagtcacgatggaacagctcttcact
gtacaccatgagatgggacatattcagtattacctgcagtacaaggacaagcctatgggc
ttccgcagtggagccaaccctggttttcacgaggctatcggtgatgttttgtccctttcg
gtttctacgcccaagcatctggaaaccattaatcttctggaatctgtgacatctgacatc
gaaactgacaccaactacctgctaaaaatggctctggagaagatagccttccttcccttt
ggctaccttattgacctctggagatgggatgtctttagtggaaagacccctccggagcgt
tacaatgctgactggtggtatctcagaacaaaatatcaaggcatctgcccacccaccagg
cgtacagaggagcactttgatgctggggcaaaataccacatccctgggaacacgccgtac
atcagatattttgtcagtttcatccttcagttccagtttcatgaaaaactttgcgaagca
gccaagcacacaggtcccttgcacacatgtgacatctaccggtctgcggaggcgggagcc
attttaaagaaagtccttcaggccggctcatctgaaagctggccagttgtgctccaggat
gctataggcactaataaattaaatgccagctcactcatgaagtactttgagccaattatt
gagtggttgaacaagcaaaatgtgaatgagacgttgggatggccagacttcaactgggtc
ccacctatgcctgaaggctacccagaagatatcgacaagaacacagatgagcttgatgcg
cagaagcttctggaagagtacaacagtacagctgaggtggtatggaatgcatacactgag
gcctcctggaagtacaacaccgacatcaatgaagccaataagcaggcaatgcttgaaaag
aacctggagatgtcagcacacaccttgaagtatggactgcaggcccgtcaatacgacacc
actgacttccaagatggctcggtcaaacgcatcattaaaaaactcagtgacatcgagagg
gctgcgctcccctctgcagaactggaagagtacaatacgctcctgtccaacatggagacc
aagtacagcgtggctgaggtctgcagagagaataatgaatgcctccctctggatccagat
ctccagaagatcatggcagagtccagggattacgatgagctgctatttgcctggaaagga
tggcgagatgctgctggcaaagtactccgtcaggattataagagatatgttgaactggcc
aacaaagctgccacactaaatggtcactctgataatggagctttctggcgttccctgtat
gaaacgcctacctttgaagaagatctggagactctgtggaaggagctggagccactctat
ctaaacttgcatgcttatgttcgaaggggtctatacaataagtatggctccaactatatc
aacctaaaggggcctattcctgctcatttacttggcaacatgtgggcacagacgtggtct
ggcataatggatttggtcataccctacccagacgctacacaggttgacgccaccccagcc
atggtgcagcagggatgggatgccatcagaatgtttcaggaatctgacaaatttttcacc
tcacttggtttggagccaatgccgccggaattctggaacaaatctatgctggagaagccg
tctgatggacgccaggtggtgtgccacgcctctgcgtgggacttctataaccgaaaagac
ttcaggatcaagcagtgcactgttgtcacaatggatgacctgatcaccgtgcaccacgag
atgggccacattcagtatttcctgcagtacaaaaaccagcccgtgtccttccgtgacgga
gccaaccccggctttcatgaggccattggagatgtacttgccttgtctgtgtcgacaccc
aaacatctgcagagcatcggcctcctggacaaggttgagaacaactatgagagtgacatc
aacttcctgatgagcattgcacttgacaagattgccttcctacctttcggctacctgatg
gaccaatggaggtggaaggtgtttgatggacgcatcccacacaccgagtacaataaagaa
tggtggaacctcagattgaagtaccagggattgtgcccacctgtaacacgcactgaggag
gactttgacccaggtgcaaagttccacatcccagctaacgttccctacgtcaggtatttt
gtcagcttcgtcatccagtttcagttccacaaagctctgtgtaatgctgccaagcataat
ggacctttatacacttgtgacatctaccaatccaaagaagctggaaagctcttaggtgat
gtaatgaagctgggcttcagcaagccctggcctgaggctatggctatgatcactggcgag
tccaaaatgagtgcccagccactcatggagtacttccaacctctcattgaatggcttgag
aaggagaacagcaagaacaatgatgttcgcgggtggccagattacgactggaagcctttt
agtgaatctccaacaggtgaagctaaaacagtggatttcctgggtttaaatgtgaacagg
tcggctgccacagtcggccagtggatcctgttggccctcggcatgctgctattggtggtc
accatccttatggcctacatgtacaggaaggcaagaaagcctgaaaagtccttgtctact
atggagctgaagcaaaaagattag

DBGET integrated database retrieval system