KEGG   Maylandia zebra (zebra mbuna): 101471827Help
Entry
101471827         CDS       T02814                                 

Gene name
kmt5b, suv420h1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101471827 (kmt5b)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101471827 (kmt5b)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101471827 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 900 aa AA seqDB search
MDSGFKVLSPVFPTQECCFISETKCNWTRGLVGMKWLGESKNMVLNGRRHGNKLTGEQTV
SPSQTRSQHPQRASLRHSKSHTRNRRCSRRFNAASLEAERRYVPSSGMTAKELCENDDLT
TSLILDPYLGFQTHKMNTRFRPIKGRQEELKEIIERFKKHDNLEKAFKALTSGDWARNIF
LHKTKAQEKLFKQHVFVYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIEYL
VGCIAELSESEENLLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRD
TACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSKAGLPVEVPVINS
KYGLRETDKRLNRLKKLGEGNRTSDSHSVGSHTDVDSQEMPKTHQSARKRTSSSSSSSGL
KYKNRTQTRQTLSRALTTSCSKQGRANNNRVPKRLRSQSKPSLSKVQLRSRKRGAEPKAL
AKRETCQLGLTDSKMSLCKGVTVKKEKDGQELVQQTLGQQGYLTRHTAKENGHLPAVQSS
EGSQCSMYRTRRSTRTLVKARETASGVKLEPSAMDGLSPVPGGVVIKTEPADMEEYLHHG
VELEHPSLDAGYARRRSSTRQKRPARIRAERTIKCEDTYGESFMQVVGSHAAEFSDCGNM
LLSFADQHRDYNCVTHGSKSFHRDKGKGSCRSQDKGKKKRRITRYDAQLILENNTGIPKL
TLRRRRDSSSSKTTDPNDPVGSSHLSASTVNSPSSSKISIKFSKDHDKDKGSSYIAKLNN
GFAPVVHSNSTKLNIQLKREDDARRLSQTKVDQISFNGDMSQGLETRNGGHLTQKVLADP
SSDDEDKEVEDDDDYFDNEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggattcaggtttcaaagtcttgtccccagtcttccccactcaagagtgttgcttcatc
tcagagactaaatgcaactggaccaggggtcttgtgggcatgaagtggctgggcgaatcc
aagaacatggtattaaatggcagacgacatggaaacaagttgactggcgagcagactgtg
agcccgagccagactcgctctcagcatccacaacgtgcatctctgcgccacagcaagagc
cacaccagaaaccgaagatgtagccgcagatttaatgcagccagtctggaggcagaaagg
cgctatgtaccctcctctggaatgactgccaaggagttgtgtgagaatgacgatctaacc
acgagcctcatactggatccatatctgggctttcagacacacaaaatgaacaccagattt
cgacctattaagggaaggcaagaagagctgaaagagataattgagcgcttcaagaaacac
gacaacttggaaaaagctttcaaagctttgacatcaggagactgggctcgaaatatattt
ctccacaagacgaaggctcaagaaaagctcttcaagcagcatgtgtttgtttatctgcgc
atgtttgctacagacagtgggtttgagattctcccttgtaaccgttactcatctgagcaa
aatggagctaaaattgtggcaacaaaggaatggaaaagaaacgataagattgagtacttg
gttgggtgcattgctgagctctcagagagcgaggagaacttactgctgcggcatggagag
aatgacttcagtgtcatgtattcgacccgcaagaactgtgcgcagctgtggcttggacca
gctgcattcatcaatcatgattgtcggccaaactgcaagtttgtgtcaacaggtcgggac
acagcttgtgtgaaagttttaagggacattgagccaggagaagaaatctcgtgctactat
ggagatggtttttttggggaaaacaatgaattttgtgaatgctatacgtgtgaaagacga
ggtactggtgctttcaaatccaaagctggactgccagtggaagtaccggtgatcaacagc
aagtatggattgcgtgagacagacaagcgcctcaacaggctgaagaagctaggggaggga
aataggacctcagacagtcactctgtaggctcgcacaccgatgtagactctcaggaaatg
ccaaaaacacatcaatctgccagaaaaagaacatcatcatcgtcatcatcatctggcctg
aagtataaaaacaggactcaaaccagacagactttgtcaagagcccttactacctcatgt
tcaaaacaaggtcgcgcaaacaataacagggtaccaaagagactaagatcccaatctaag
ccttcgctaagtaaagtccagttgcgaagtcggaaaaggggtgcagagcccaaggcactg
gccaaacgagagacctgccagttgggtctcacggactcaaagatgtcgctgtgtaaaggc
gtcactgtaaagaaggagaaggatgggcaggagctagtgcagcagacactgggccagcaa
ggctatctgacacgtcatactgccaaggaaaatggccacctcccagctgtgcagagcagc
gaaggcagccagtgttcgatgtacagaactcgcaggtccacaaggacccttgtaaaggct
cgggaaacagcatctggtgttaagctagagcccagcgccatggatggtttgagtccagtc
cctggtggggtggtcatcaaaacagagccagctgacatggaggagtacctccaccacgga
gttgagctagaacatccatcattagatgctggctatgccagaagacgctcaagcaccagg
cagaaacggccagcacggatcagggccgagcggacaattaaatgcgaagacacatatggg
gagtccttcatgcaagtggttggcagccatgctgcagagttctcagattgtggaaatatg
cttttgagctttgctgaccaacatagagactacaattgcgtcacccatggcagcaaatct
ttccaccgggacaagggaaagggtagttgccggtctcaggacaaggggaagaagaagcgt
cggatcacaagatacgatgctcagttgatcctagagaataacacaggcatccccaaactg
acgctccgccggcggagggatagcagcagtagcaagaccactgaccccaacgatcctgtt
ggctcctcccatctttcggcatctacggtcaattcaccttcttcgagcaaaattagcata
aagttcagcaaggatcatgacaaggataaaggcagctcctacatcgccaaactgaataac
ggttttgcccctgtggtccacagcaattccaccaagctgaacatccagttgaagcgggag
gatgatgcacgaagactatcacagacaaaggtggaccagatttcctttaatggagacatg
agtcaaggtctagagaccaggaatggtggacatctgacccaaaaggtcctggcagaccct
tcgtctgatgatgaggacaaggaagtggaggatgacgatgactactttgataatgagttt
gaagacgatttcattccacttcctccagcaaagcggctccgactcattgtgggtaaagac
tccatagacattgatatctcctccaggaggagagaggatcagtctctgaggctcaatgca
taa

DBGET integrated database retrieval system