KEGG   Maylandia zebra (zebra mbuna): 101476828Help
Entry
101476828         CDS       T02814                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    101476828 (gad1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101476828 (gad1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101476828 (gad1)
   00430 Taurine and hypotaurine metabolism
    101476828 (gad1)
Enzymes [BR:mze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101476828 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 591 aa AA seqDB search
MAASAPSSSGGDPDPNSTNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQKNNNLEERSR
IVSSFKERTAKNLLSCDNSGGEARFRRTESDFSNLYARELLPAKNGEEPTMQFLLEVVEI
LTSYIRKTFDRSTKVLDFHHPHQLLEGIEGFNLELSDQPESLEQILVDCRDTLKYGVRTG
HPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPDGE
GDGIFSPGGAISNMYSVMIARYKFFPEVKTKGMAAAPRLVLFTSEHSHYSIKKASAALGF
GTENLILLNTDERGRVIPDDLEAKVIEAKRKGYVPLFVTATAGTTVYGAFDPINEIADIC
EKYNMWLHVDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVRERGL
LQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDKC
LDLSAYLYNKIKNREGFKMVFKGEPQHTNVCFWYIPPSLRSLPDGEERRQRLHKVAPKIK
AMMMESGTTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLVEEIERLGHDL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgcaccctcctcttctggcggcgatccggatcccaactcgacaaattta
cggccaccgggctcaagttatgatgcttggtgtggagttgcgcatggctgtactagaaaa
ttggggatgaaaatatgtggattcctgcagaagaacaacaatctggaggagaggagcagg
attgtgagttccttcaaggagcgcacagccaagaacctgctgtcctgcgataacagcggc
ggagaggcgcgtttcaggcgaacagagtccgacttctccaatctgtacgccagagagctg
ctacctgccaaaaatggagaggagccaaccatgcagttcttgctggaggtcgtggaaatc
ctcaccagctacatccggaagacctttgacaggtctaccaaggtcctggacttccaccat
ccccaccagctgctggagggcatcgagggcttcaacctggagctctctgaccagcctgag
tctctggagcagatcctagtggattgcagagacacgctaaaatatggagtgagaacaggt
caccccaggttctttaaccagctctccaccggattagatattgtggggttggcaggagag
tggcttacatctacagccaacactaatatgttcacctacgagatcgcccccgtttttgtg
ctaatggagcagctgactctgaaaaaaatgagagagattgttggctggccagatggagag
ggtgatgggatattttctccaggtggagcaatttccaacatgtacagtgtgatgattgcc
agatacaagttcttcccagaagtgaagaccaaaggcatggcagctgcacccagactggtc
ctcttcacctcagagcatagccactactccatcaagaaagcaagcgcagctctgggcttc
ggaacagagaacctgatccttttgaacacagatgaaagagggagagtcattcctgatgac
ttagaagccaaagtaatagaggccaagcgaaaggggtatgttccactgtttgtgactgcc
accgctggtaccaccgtctacggagcctttgatcccatcaatgaaattgccgacatctgt
gaaaagtacaatatgtggcttcatgtggatggtgcgtggggaggaggtttgctgatgtcc
aggaaacacagacacaagctgaatggagtggagagggccaactcagtcacctggaaccct
cacaagatgatgggagtgccactgcagtgctctgccattctagtcagagagcggggactg
ttacaaggctgcaactctatgtgtgctggatacctcttccagccagacaaacagtacgac
gttacatacgacaccggtgacaaagccattcagtgtgggcggcatgtcgatatcttcaag
ttctggctgatgtggaaggcaaagggaacagtaggatttgagcagcatattgataagtgc
ctggatctgtcagcctacctctacaataaaatcaaaaacagagagggattcaagatggtg
ttcaaaggagagccgcagcacactaatgtctgcttctggtacattccaccgagcctgcgc
agtttacctgatggtgaagagagacgtcagaggttgcacaaggtggctccgaagatcaaa
gcaatgatgatggagtctggcactacgatggtgggttaccagccacaaggagataaggtc
aacttctttcgcatggtcatctccaaccctgccgccaccaggtcagacatcgatttcctg
gtcgaggagattgagcgactggggcatgacttgtaa

DBGET integrated database retrieval system