KEGG   Maylandia zebra (zebra mbuna): 101482510Help
Entry
101482510         CDS       T02814                                 

Definition
(RefSeq) hexokinase-1 isoform X2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00051  Fructose and mannose metabolism
mze00052  Galactose metabolism
mze00500  Starch and sucrose metabolism
mze00520  Amino sugar and nucleotide sugar metabolism
mze00524  Neomycin, kanamycin and gentamicin biosynthesis
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze04910  Insulin signaling pathway
Module
mze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mze_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101482510
   00051 Fructose and mannose metabolism
    101482510
   00052 Galactose metabolism
    101482510
   00500 Starch and sucrose metabolism
    101482510
   00520 Amino sugar and nucleotide sugar metabolism
    101482510
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101482510
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101482510
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101482510
Membrane trafficking [BR:mze04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101482510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 101482510
NCBI-ProteinID: XP_004571857
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDIMNRFRREMENGLERDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQIYETPDDITH
GSGAQLFDHVADCLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKKFKASGV
EGMDVVKLLNKAIKKRGDYQADIMAVVNDTTGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDNGSLEDIRTEFDREIDRGSINPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVQHVCTIVSFRSANLISATLGAILCRLKENKGVVRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLTEQARHIQQTLAEFRLS
KNQLLEVKKRMKVEIERGLKKDSHKDATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRSVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCHQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIEIVPGTEGRMCVNMEWGAFGDNGCLDD
IRTTYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAA
VVDKIRENRRLDHLDVTVGVDGTLYKLHPHFSRIFQQTVKELAPKCDVNFLLSEDGSGKG
AALITAVGCRQRELDAQQH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcagcttctggcctactacttcaccgagttgaaggatgatcaactcaaa
aagatcgataagtacctgtactccatgcggttctccgatgagacgcttaaggacatcatg
aacaggttccgcagggaaatggagaatgggcttgaacgtgacaccaaccccactgccacc
gtgaagatgctgcccacgttcgtcaggtccattcctgatggatcagaaaagggggacttc
atagctctggaccttggagggtcgaactttcggatcctgcgtgtcaaagtgacacaagac
aagaagcaaccagttcagatggagagccagatctatgagacccctgatgacattacccat
gggagtggggcacagctctttgaccatgttgcagattgcctcggtgacttcatggagaaa
caaaaaatcaaggataaaaaacttcctgtgggattcacgttctctttcccatgtgcccaa
accaaactagatgaggctgtcttactaacatggacaaagaagtttaaagccagtggtgta
gaaggcatggacgttgtgaagcttctaaacaaagctatcaagaaacgaggggactaccaa
gcagacatcatggcagtggtgaatgacaccactggcactatgatgacttgtggatttgac
gatcagcgctgtgaagtgggaatcattataggaacgggaacaaatgcctgctacatggag
gaactgcgtcacattgacctggtggaaggagatgaaggccggatgtgcatcaacactgaa
tggggtgcttttggggataatgggtccctagaggacatccgcacagagtttgaccgtgag
attgacagaggatcgatcaacccaggaaaacaattgtttgaaaagatggccagtggcatg
tacatgggagaactggtacgtctcatcctggtcaagatggccaaagaggggctgctgttt
gagggacgaataacccccgagctcctgacgagaggaaagattgagacgaaacatgtatct
gcaattgaaaagactaaggaaggactgaagaagtgcatggaaatcctgacaaggcttgga
gtggagccctcagatgaagactgtctggctgtgcagcacgtgtgcaccatcgtatccttc
cgctcagctaatctaatatctgcaactctgggagccattctttgtcgcctaaaagagaat
aaaggagttgtgcggcttcgtaccactgtcggcattgatggatccctgtacaagatgcac
cctcaatatgcccgtcgtctgcacaaaactgtgcgtcgcttagtcccagactcagatgtc
cgtttcctgctgtccgaaagcgggagtgggaaaggagcggccatggtgacagcagtggca
taccgtttaactgagcaggcgcgccacattcagcagactttggcagaattccggttgagc
aaaaatcagttgttagaggtaaagaaaaggatgaaggtggagattgaaagaggcctgaag
aaggacagccacaaggacgctacagtcaaaatgttgcccacctttgttcgaagcacaccg
gacggaacagaaaatggtgatttccttgctctggaccttggcggaacgaacttccgcgtg
cttctggtcaagattcgcagtgggaaaagacgatcagtggagatgcataacaaaatctat
gccattcccatagaagtcatgcagggcacaggggaagagctttttgatcacattgtgcac
tgcatctctgatttcctggactacatgggaatgaaaagtgctcgactcccactgggtttc
actttttcgttcccctgccatcagaccagcctggatgcaggcatccttgtaacatggacc
aaaggcttcaaggccacagactgtgagggtgaagatgtagtggagcttcttcgggaagca
atcaaaaggaaagaggagtttgagctggatgtggtagccatagtgaatgacacagtgggg
acgatgatgacctgtgcatatgaggagcccacatgtgaggtgggactgatcgcaggaacg
ggcagcaatgcttgttatatggaagaaatgaagaacattgagatagtgccgggtaccgag
ggtcggatgtgtgtcaatatggagtggggggcatttggagacaatggctgtctggatgac
atcaggacaacatacgaccaggcagtggatgagaactcactcaacgaaggcaaacaaaga
tatgagaagatgtgcagtggaatgtatcttggtgagattgtacggcagattttgattgat
ctgaccaagcgtggcttcctgttccggggacaaatctcagagacacttaagaccaggggc
atctttgagacaaagtttctgtcacagatagaaagcgatcgtctggccttgctgcaggtc
agagcgatcctgcagcagctggggctcgacagcacctgtgatgacagtattatcgtcaag
gaggtgtgcggcacagtgtcccgccgagcagctcaactgtgcggagctggaatggctgca
gtggtggacaagatccgtgagaacagaagactggaccacctggatgttacagtgggtgtg
gatggcacactctacaagctgcacccacatttttctcggatcttccaacaaactgtgaag
gaactcgcccccaaatgtgatgtcaacttcctgctgtctgaggacggcagcggtaaggga
gctgccctcatcactgctgtgggctgccgccagagggagctggatgcccagcaacactga

DBGET integrated database retrieval system