KEGG   Maylandia zebra (zebra mbuna): 101487556Help
Entry
101487556         CDS       T02814                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101487556 (gpd2)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101487556 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 EF-hand_8 FAD_oxidored Pyr_redox_2 GIDA Pyr_redox_3 Thi4 EF-hand_4 EF-hand_5 HI0933_like NAD_binding_8 EF-hand_9 EF-hand_10 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 101487556
NCBI-ProteinID: XP_004575410
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFRRALKRTALVGGGAVATAFGLSQLIEYRKTQARLAQVAAEAELKVPFIDELPSRQAQ
LAALTNTEEFDVLVVGGGATGAGCALDAVTRNLKTALVERSDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDYEQYMMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWAGIKMY
DLVAGIQCLKSSYVLSKTKALELFPMLKKDKLVGAIVYYDGQHNDARMNLAIALSAARYG
AAIANYTEVIHLLKKKDPQSGREKVCGARCRDVITGQEFDVRAKCVINATGPFTDALRKM
DNQEASNICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWENMTIAGTTDTPTS
VTAHPIPGEDDINFILREVRNYLSPDVEVRRGDVLAAWSGIRPLVTDPSSKDTQSICRNH
IVSISDSGLVTIAGGKWTTYRSMAEETLDATIKAHRLSADSCKTVGLMLEGAKGWTPTLY
IRLVQDYGLEKEVAQHLASTYGGRAFDVAKMAQVTGQRWPIVGKRLVSEFPYIESEVLYA
IKEYACTAIDVIARRTRLGFLNVQAADEALPRIVQIMGKELDWSQEKRTEELEAARKFLY
HEMGYRSRSEQITKTSEINLDNHEVARYKKRFHKFDKESKGFITTVDVQRVLQSINVHID
ENALHEILNEVDLNKNGQVEIDEFLQLMSAVKKGHVSDSRLAILMKTAEETLDQREPVSV
DRSGGGV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaggagggctctgaaacggacggcccttgtaggcggtggggcggttgccacg
gcgtttggcctgtcacagctgatcgagtacagaaagacacaggctcggttagcccaagtg
gcggcagaagcagagctgaaggttcccttcatcgatgagctcccctctcggcaggcgcag
ctcgcagcgctgacaaacacagaggagttcgacgttctggttgtcggaggaggggccacg
ggggcaggatgtgccttagacgctgtcacacgcaaccttaagactgctctcgttgagaga
agcgacttctcttctggaacaagcagccgaagcaccaagctcatccacggtggagtccgc
tatctgcagaaggccatcatgaagctggactacgagcagtacatgatggtgaaagaggcc
ctccatgagcgagccaacctgctggagattgcacctcacctgtctgcgccgttacccatc
atgcttcctgtttacaaatggtggcagttgccttactactgggcagggatcaagatgtac
gacttggtggcggggatccagtgcctgaagagcagctacgtcctcagcaagacgaaggcc
ttggagctcttccccatgctgaagaaggacaagttggtgggggccatcgtgtactacgac
ggtcagcacaatgatgcccgtatgaacctggccatcgccctcagtgccgcccgctacggc
gccgccatcgcaaactacaccgaggtgattcacctgctgaagaaaaaggacccacagagc
ggcagagagaaggtgtgcggtgcccgctgcagggacgtcatcacagggcaggaatttgac
gtgagggccaagtgtgtgatcaacgccaccggaccgttcacagacgctctgaggaagatg
gacaaccaggaggcctcgaacatctgccagcccagtgctggagttcacatcgtcatcccc
ggatactacagtcctgacaacatgggtctcctcgatccagccaccagcgatggtcgtgtc
atcttcttcctgccgtgggagaacatgaccatcgccggaacaaccgacacccccactagt
gtgacagcccacccaatcccaggggaggacgacatcaacttcatcctgagggaggtccgc
aattatctcagccctgatgtagaagtgcgtcgaggagacgtgttggcagcgtggagcggc
atacgtcccctagtgacggaccccagctccaaagacacccagtccatctgcaggaaccac
atcgtcagcatcagtgacagcggactggtcacaatcgctggtgggaaatggaccacctac
agatctatggctgaagagaccctggacgcaacaattaaggcccaccgcctctcagctgac
tcctgcaagactgttggtctgatgctggagggagccaaggggtggacgccgaccctttac
atccgcctggtgcaggactacggcctggagaaagaggtcgctcaacacctggcctccacg
tatgggggaagggcattcgacgttgccaaaatggctcaggtcaccgggcagagatggccg
atcgtcgggaaaagattggtgtctgaattcccgtacatcgagagcgaggtgctatatgcg
attaaggagtacgcctgcaccgccatcgatgtcatcgcccggcgaactcgcctgggcttc
ctgaatgtgcaggcggctgatgaggcgctcccacgtatcgtccagatcatgggcaaagaa
ctggactggagtcaggagaagaggacggaggaacttgaggcagcgaggaagttcctgtac
catgagatgggctacaggtctcgctctgagcaaataaccaagacgtctgagattaacctg
gacaaccatgaagtagccaggtacaagaagcgtttccataagtttgacaaagagagcaaa
ggattcatcaccactgttgacgtccagcgagttttacagagcatcaatgtgcacattgat
gaaaacgcgctccatgaaatccttaatgaggtggacctcaacaagaacggacaagtcgaa
attgatgaattcctgcagctgatgagcgccgtgaagaagggacacgtgtcggacagccgc
ctggccattctgatgaaaactgcagaggagactctggatcagagggaaccggtgtcggtg
gaccgaagcgggggcggagtctga

DBGET integrated database retrieval system