KEGG   Methanosalsum zhilinae: Mzhil_1092Help
Entry
Mzhil_1092        CDS       T01541                                 

Definition
(GenBank) DNA ligase D, 3'-phosphoesterase domain protein
Organism
mzh  Methanosalsum zhilinae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1189166..1189753)
Genome map
AA seq 195 aa AA seqDB search
MSENLAEYKKKRDFNKTSEPSGNRTEEHKYPVFVIQKHNARNLHYDLRLEVDGVLKSWAV
PKGPSMDPSKKRLAIETEDHPIEYANFEGVIPEDEYGGGTVIVWDKGTYENINEKDDKLI
SMKDSIKKGHVKVILSGEKVQGKFALIKSSGRNKGQWLLLKMKGEDISTDHNGDILDIRP
ESVLSGKTIEDIEKI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaatttagctgaatacaaaaagaaaagagattttaataaaacttcagaacca
tccggaaatcgcactgaggaacataagtatccagtatttgttattcaaaaacataatgca
cgtaatcttcattatgatctcagacttgaagttgatggtgtattgaagtcatgggctgtt
ccaaaaggaccttctatggatccttctaagaaacgtcttgcaatcgaaactgaagatcat
cccattgaatatgctaactttgaaggtgtcattcctgaagatgaatatggaggtggaact
gttattgtgtgggataagggaacctatgagaacataaatgagaaagacgataaattgatc
tcaatgaaggattctatcaaaaaaggtcatgttaaagtcattctcagtggtgagaaggta
cagggaaaatttgcacttataaagtcatctggtagaaataaaggccaatggctgcttctt
aaaatgaaaggtgaagatatcagtacagatcataatggagatattttagatattcgtcct
gagtctgtcctgagtggaaagacaattgaggatattgaaaagatttag

DBGET integrated database retrieval system