Necator americanus (New World hookworm): NECAME_00612 Help Entry NECAME_00612      CDS       T04867                                  Name (RefSeq) Ras family protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nai  Necator americanus (New World hookworm) Pathway nai04010   MAPK signaling pathway nai04145   Phagosome nai04148   Efferocytosis nai04310   Wnt signaling pathway nai04361   Axon regeneration Brite KEGG Orthology (KO) [BR:nai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     NECAME_00612    04310 Wnt signaling pathway     NECAME_00612  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     NECAME_00612    04148 Efferocytosis     NECAME_00612  09150 Organismal Systems   09158 Development and regeneration    04361 Axon regeneration     NECAME_00612  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nai04131]     NECAME_00612   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nai04147]     NECAME_00612    04031 GTP-binding proteins [BR:nai04031]     NECAME_00612 Membrane trafficking [BR:nai04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     NECAME_00612  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     NECAME_00612   Macropinocytosis    Ras GTPases     NECAME_00612  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     NECAME_00612 Exosome [BR:nai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NECAME_00612   Exosomal proteins of other body fluids (saliva and urine)    NECAME_00612   Exosomal proteins of colorectal cancer cells    NECAME_00612   Exosomal proteins of bladder cancer cells    NECAME_00612 GTP-binding proteins [BR:nai04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     NECAME_00612 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  25340656 NCBI-ProteinID:  XP_013297428 UniProt:  W2T1T8 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MSSPSRQIKCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMTLDNHTVNLGLW DTAGQEDYDRLRPLSYPQTDVFVLCFSIVSPVSFDNVATKWIPEIRQHCPDAPILLVGTK LDLRDEANPRSTGTEDRPPITKSQGQKCAQKIKAVKYLECSALTQQGLKQVFEDAVRAVI NPKPLKQKKSCTLL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgtcaagcccttcgaggcagattaagtgtgtcgtggtcggcgatggaactgttggaaag acttgtatgttgatttcatatactaccgactcatttcctgttcaatatgtgcctacagtt tttgacaattactctgctcagatgacattggacaatcatactgttaatctagggttatgg gatactgctggacaggaagactacgatcggctgagacctttaagttacccacaaacagac gtgttcgttctgtgcttcagcattgtctcaccagtctccttcgataatgtggctaccaaa tggatcccagaaattcgtcaacattgtccagatgcgcctattttgctcgttggtaccaaa ctggatctacgagatgaggcgaatccacgctctactggcactgaggataggccaccgatt acaaaaagtcaaggacagaaatgtgcgcagaaaatcaaagcagtgaaatatttggaatgt tcggctctcacacaacaaggcttgaaacaggtgttcgaggatgcagtaagagctgttatc aatccaaaaccgctaaaacagaagaagtcatgcacgttactttaa

DBGET integrated database retrieval system