Necator americanus (New World hookworm): NECAME_08550 Help Entry NECAME_08550      CDS       T04867                                  Name (RefSeq) Ras family protein   KO K07888   Ras-related protein Rab-5B Organism nai  Necator americanus (New World hookworm) Pathway nai04137   Mitophagy - animal nai04144   Endocytosis nai04145   Phagosome nai04148   Efferocytosis Brite KEGG Orthology (KO) [BR:nai00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     NECAME_08550    04145 Phagosome     NECAME_08550    04137 Mitophagy - animal     NECAME_08550    04148 Efferocytosis     NECAME_08550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nai04131]     NECAME_08550   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nai04147]     NECAME_08550    04031 GTP-binding proteins [BR:nai04031]     NECAME_08550 Membrane trafficking [BR:nai04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     NECAME_08550  Endosome - Lysosome transport     NECAME_08550 Exosome [BR:nai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NECAME_08550   Exosomal proteins of other body fluids (saliva and urine)    NECAME_08550   Exosomal proteins of colorectal cancer cells    NECAME_08550   Exosomal proteins of melanoma cells    NECAME_08550 GTP-binding proteins [BR:nai04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     NECAME_08550 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SDR-like Gtr1_RagA Motif Other DBs NCBI-GeneID:  25348579 NCBI-ProteinID:  XP_013303556 UniProt:  W2TID4 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MVHQVCLDDATVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKE LQRQASPNIVMALAGNKADMANRRTVEYEEAQAYAEDNALLFMETSAKTSMNVNDIFMAI AKKLPIGPPAGEPSGTVDMNQPQQAQKGNCCK NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggtgcaccaggtttgcctagatgatgctacggtaaagtttgaaatctgggacacagca ggtcaagaacggtaccattcgctggctcctatgtactatagaggtgctcaggctgcaatt gtagtgtacgacattacaaatcaggaatctttccaaaaagctaagaattgggtgaaagaa cttcaacgacaagcgtctccaaatattgttatggctctagcgggtaacaaggccgatatg gctaataggcgaactgttgagtatgaggaagctcaggcctatgcagaagacaacgctctg ctctttatggaaacttcagcaaagacatcgatgaatgtgaacgatatttttatggctatt gcgaagaagctaccaatcggtcccccagccggagaaccaagtggtacagttgacatgaat cagccacaacaggcacagaagggtaattgctgcaagtag

DBGET integrated database retrieval system