KEGG   Nocardiopsis alba: B005_1187Help
Entry
B005_1187         CDS       T02218                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nal  Nocardiopsis alba
Pathway
nal00564  Glycerophospholipid metabolism
nal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    B005_1187
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B005_1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFR06182
UniProt: J7L6V8
LinkDB All DBs
Position
complement(1242387..1244108)
Genome map
AA seq 573 aa AA seqDB search
MATTWLGPKGRATALASMADEELDVLVVGGGIVGAGIALDAVSRGLSTGLIEARDFASGT
SSRSSKLIHGGLRYLEQLDFELVQEALQERGLLLTRLAPHLVRPVPFLFPFQHHWERFYI
GAGVALYDTLAMTSRNNRGLPSHRHLTRSGAMRVFPALKRSALAGAIQYWDCQVDDARYV
TTVLRTAAGLGARIASRVQAVEFLREGEHVVGATAADLESGERLRIRARQVVNAAGVWTD
DIQEMVGGRGQIHVSASKGVHLVVPRDRIQASSGMILQTEKSVLFVIPWGRHWIIGTTDT
PWDLDKENPAASRADIDYVLDHVNQVLRTPLGRDDVEGVYAGLRPLLSGESEETSKLSRE
HTVAHPVPGLVLIAGGKYTTYRVMAKDAVDAVAHGLGGGVPESVTDRLPLVGADGYSALY
NQRHRLARDSGLHVSRISHLLRRFGSAVHDVLDLIKEREDLGRPLAGSDDYLRAEVVYAV
EAEGARHLEDVLSRRTRITFETWDRGIAAAEEAAELMAEPLGWDRAQVEREVEYYRKGIE
AERAAQEQDTDQEADAIQHGAPEIVPDVHADRS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccacctggttgggaccgaagggccgcgccacggcgctggcctccatggccgac
gaggaactcgacgtgctcgtggtcggaggtgggatcgtgggggcggggatcgccctggac
gcggtctcgcgcggcctgtccacggggttgatcgaggcgcgcgacttcgcctcgggcacc
tccagccggtccagcaaactgatccacggcgggctccgttacctggaacagctcgacttc
gaactcgtccaggaggcgctccaggaacgcgggctcctgctcacccgactcgccccgcac
ctggtccgaccggtgccgttcctcttccccttccagcaccactgggagcgtttctacatc
ggggccggcgtcgccctctacgacaccctcgccatgacctcgcgcaataaccgggggctg
ccctcgcatcggcatctgaccagatccggtgcgatgagggtcttccccgcgctcaagaga
agcgccctcgccggagcgatccagtactgggactgtcaggtcgacgacgcccgctacgtc
accacggtgctgaggacggcggccggcctgggcgcgcggatcgcctcgcgggtacaggcg
gtcgagttcctgcgcgagggcgagcacgtggtcggggcgaccgcggccgacctcgagagc
ggggagcggctgcggatccgggcccggcaggtggtcaacgccgccggcgtgtggaccgac
gacatccaggagatggtgggcggtcgcggtcagatccacgtgagcgcctccaagggcgtg
cacctggtggtgccgcgcgaccgtatccaggcctcctccgggatgatcctccagaccgag
aagagcgtgctcttcgtgatcccctggggacggcactggatcatcggcaccaccgacacc
ccctgggacctggacaaggagaacccggcggcgagtcgggccgacatcgactacgtcctg
gaccacgtcaaccaggtcctgcgcacgccgctgggccgcgacgacgtcgagggcgtctac
gcgggtctgcgcccgctgctgtcgggggagtcggaggagacctccaagctgtcccgcgag
cacacggtcgcgcatcccgtgccgggcctggtgctcatcgcgggcggcaagtacaccacc
taccgggtcatggccaaggacgccgtggacgcggtggcgcacggcctgggcggaggtgtt
cccgagtcggtcaccgatcggctgccgctggtgggcgcggacggctactcggcgctgtac
aaccagcgtcaccggctggcccgcgactcgggcctgcacgtctcccggatctcgcatctg
ctgcgccgtttcgggtcggccgtccacgacgtgctcgacctgatcaaggagcgtgaggac
ctgggccgcccgctggccgggtccgacgactatctgagggccgaggtcgtctacgccgtg
gaggccgagggcgcccgacacctggaggacgtcctgtcccggcggacccgcatcacgttc
gagacctgggaccgggggatcgccgccgccgaggaggcggccgagctgatggccgaaccc
ctcgggtgggaccgggcgcaggtggagcgcgaggtggagtactaccgcaagggcatcgag
gccgaacgcgccgcccaggaacaggacaccgaccaggaggccgacgcgatccagcacggg
gcgccggagatcgtcccggacgtgcacgccgaccgttcctga

DBGET integrated database retrieval system