KEGG   Anabaena azollae 0708: Aazo_1696Help
Entry
Aazo_1696         CDS       T01260                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
naz  'Nostoc azollae' 0708
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aazo_1696
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aazo_1696
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_1696
   00680 Methane metabolism
    Aazo_1696
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Aazo_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1758379..1761432)
Genome map
AA seq 1017 aa AA seqDB search
MGSLLYSSSPAVNLYPSELFLRHRLQVVEELWESVLRQECGQKMVDLLGQLRDLCSPEGQ
ATHDQTASAVELIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLTRYSDSGTINQE
HLANIIYSTNQREDDLPVTKELGADSLSQSWTDTTPIKQKGTFAALFPLLFKLNVPPQQI
QRLISQLDIRLVFTAHPTEIVRHTIRDKQRQVVDLLQHLDSLQNRSGGYPWEAQEVKERL
LEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRLKYSLEQTFPWLEPP
SKNFCSFGSWVGSDRDGNPSVTPEVTWKTACYQRKMVLGRYIQSVKQLIELLSVSMQWSD
VLPDLLESLELDQSTMSDVYDALALRYRQEPYRLKLAYVLRRLENTRDHNLALYSRERPA
NEDSPMYRSGAEFLSELRLVQRNLTETGLSCRELENLICQVEIFDFNLTQLDIRQESSRH
CDALNEILEYLQVLPLSYNQLSEAQRVSWLTGELQTRRPLIPGELPFSEKTNDVIETFRV
VRSLQQEFGINICQTYIISMCREVSDVLEVLLLAKEARLFDPAIAVGSIRVVPLFETVED
LQRSRSVMKKLFELPLYRAFLAGGYEALNSENTPPDTQPPNSPSSPTLNPNLQEVMLGYS
DSNKDSGFLSSNWEIHKAQKSLQKIAEQYGLHLRIFHGRGGSVGRGGGPAYEAILAQPGN
SINGRIKITEQGEVLASKYSLLDLALYHVETITTAVVQASLLRTGFDDIEPWNEIMEELS
MRSRQHYRGLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFS
WTQTRFLLPSWYGLGTALQEFLNEQPEEHLKLLRYFYVKWPFFKMAISKAEMTLAKVDIE
MAHHYVQELSNPEDKAQFDKVFEQIASEFYLTRDLVLNITGHQRLLDGDPILQRSVQLRN
GTIVPLGFIQVSILKRLRQYKNTTTSGVINSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccttttatactcttcatccccagcagtgaatctttacccctcggaattattc
ttgcgtcatcgtctacaggtagtagaggaattgtgggagtcagttcttcggcaagaatgt
ggtcaaaagatggtagatctattgggacaattgcgcgatttgtgttccccagaaggacaa
gctactcatgaccaaaccgcctctgctgtggagttaattgaacaactgaatatcaacgag
gctattcgtgctgctcgtgcttttgctctttattttcagttgattaatatcatagagcag
gaatacgaacaaaagcagcagttaactcgctattctgattcaggcacaatcaatcaggaa
catctcgccaatattatttattccactaaccaaagagaagacgatttacctgtaactaag
gaactaggagcagattccctatcacaaagttggacagacactacgccaattaaacaaaaa
ggcacatttgcggcattatttcccctgttgtttaaactgaatgtaccaccccagcaaatt
caacggttgatttctcaactagatattcgcttggttttcacggcgcaccccacggaaatt
gtccgtcatacgatccgagataaacagcgacaggtagtagacctcttgcaacatctggat
agcttgcaaaatcgttctggtggctatccttgggaagctcaagaagtgaaagagcgttta
ttggaagaaatccgcctgtggtggcgtacagatgaactgcaccagttcaaaccaacggtg
ctggatgaagtagattatgctctgcactatttccaagaagtcttatttgatggtattccc
caactgtataaacgtctcaaatattccctagaacaaacatttccttggttagaaccacca
agtaaaaatttctgttcctttggttcttgggtaggttcagatagggatggaaatccgtca
gtgacaccagaagttacatggaaaacagcttgttatcagcggaaaatggtgttgggaaga
tatattcagtcggtgaagcagctgattgaattattaagtgtgtccatgcagtggagtgat
gtgttgccagatttgctggagtcactggagttagatcagtctacgatgagtgatgtatat
gatgctctggcgttgcgctatcgtcaagaaccatatcgcttaaagttggcctatgtgctg
agaagattggaaaatacacgcgatcacaatctggctttatatagtcgagaaagaccagca
aatgaagattcccccatgtatcgttcaggggctgaatttttatcagaactgcggttggtt
caacgcaatttgacagaaacgggtttaagctgtcgagagttagaaaatctcatatgtcaa
gtggaaatttttgactttaacctgactcagctagatattaggcaagaatcatctcgtcat
tgtgatgcactgaatgagattctcgaatacctgcaagttttacccctatcttataaccaa
ctatcagaagctcaaagagtgtcttggttaactggggaactgcaaacaagacggccgtta
attcctggagagttgccattttcagaaaaaaccaatgatgtaattgaaaccttccgagtt
gtgcgatcactacaacaagaatttggcatcaacatctgtcaaacttacattatcagtatg
tgccgggaagtcagcgatgttttggaagttctgctcttagccaaagaagccagactattt
gatccagcgatcgctgtaggttcaattagagtcgtcccactatttgagactgtagaagac
ttacaacgctctagaagcgtgatgaaaaaactttttgaactccccctatatcgcgccttc
ttagctggtggctatgaagcacttaactccgaaaatactcccccagatacccaaccaccc
aactctccatcttcacccaccctgaaccccaacttgcaagaagtgatgctggggtattct
gacagtaataaggattctggtttcttaagcagcaactgggaaattcacaaagcccaaaaa
tcactccagaaaattgccgaacaatatggcttacacctgcggattttccacggacgcggc
ggttctgtaggtcggggtggtggccctgcttatgaagcgattttggctcaacctggtaac
agtattaatggacgcatcaagattactgaacaaggagaagttttagcttctaaatattcc
ttgctggacttggctttatatcatgtagaaaccatcacaactgcggtagttcaagctagt
ttgttgcggacagggtttgatgatattgaaccatggaatgagatcatggaagaattgtca
atgcgatcgcgccaacattatcgcggtctaatttacgaacaacccgattttatcgacttc
ttccaccaagtcacccccattgaagaaatcagccaactgcaaattagttcgcgtccagcg
cgacgaccatcgggtaaaaaagatttaagcagtttgcgcgctattccttgggtattcagc
tggacacaaacccgattcttgttaccttcttggtatggcttaggtacagctttacaagag
ttcttgaacgaacagccagaagaacacctgaaattgctgcgctatttttatgttaaatgg
cctttcttcaaaatggcaatttctaaagcggaaatgaccttggcaaaagtagacattgaa
atggcacatcattacgtccaggaactatccaacccagaagacaaagcccagtttgataaa
gtatttgagcaaattgctagtgaattttatctaactagagatttggtcttaaatatcact
ggacaccaacgacttttagacggtgatcccatcttgcaacgttccgtacaattacgtaat
gggacaattgtgccattaggatttatacaagtttctatcctgaagcgtttgagacagtac
aaaaacaccacgacctctggagtaattaactcccgttacagcaaaggagagttgcttaga
ggagcattattaaccattaacggtattgctgcaggaatgagaaatacaggttga

DBGET integrated database retrieval system