KEGG   'Nostoc azollae' 0708: Aazo_2151Help
Entry
Aazo_2151         CDS       T01260                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00630  Glyoxylate and dicarboxylate metabolism
naz00710  Carbon fixation in photosynthetic organisms
naz01100  Metabolic pathways
naz01120  Microbial metabolism in diverse environments
naz01200  Carbon metabolism
Module
naz_M00165  Reductive pentose phosphate cycle (Calvin cycle)
naz_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
naz_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aazo_2151
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_2151
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Aazo_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ADI64165
JGI: Aazo_2151
UniProt: D7DWZ2
LinkDB All DBs
Position
complement(2234666..2234995)
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQIAKQVQYILNQGYIPAVEFNETSEPTELFWTMWKLPL
FSAKTTQEVLGEVQACRSQYGNCYVRVVGFDNIKQCQVLSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccaaaagagcgccgttacgaaaccctctcttatcttcctcctctatct
gacgcgcaaatcgccaagcaagttcagtacattctgaaccaaggctacatcccagcagtt
gagttcaacgaaacttctgaacctactgaattattctggacaatgtggaagctacctttg
tttagtgctaaaacaactcaagaagtattaggtgaagttcaagcttgccgttctcagtat
ggtaactgctatgttcgtgttgttggttttgacaacatcaaacagtgccaagttctcagc
tttatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system