KEGG   'Nostoc azollae' 0708: Aazo_4617Help
Entry
Aazo_4617         CDS       T01260                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
naz  'Nostoc azollae' 0708
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Aazo_4617
Enzymes [BR:naz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Aazo_4617
Transporters [BR:naz02000]
 Other Transporters
  Pores ion channels [TC:1]
   Aazo_4617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4724362..4724946
Genome map
AA seq 194 aa AA seqDB search
MMLTLYHLPISQNSRRVWITLIDKGLEFELVEVQLSAEQFKPEFLAINPFHHIPALVDAG
FNVIESLAILDYLEVKYPTPVMLPKDAEDLAIVRMVEIVSVNELLPAITPLMSVILDLPG
KNAEAIEQAKTKISTALNFFENQLDDRPYFGNENLTLAEIVAGSIVLWVPRGGIYLDDYP
TLKAWYDHLVPLPA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcacactttatcatttgccaatttctcaaaattcacgccgagtctggattaca
ttaatagacaaaggcttggaatttgaactggtagaagttcaactaagtgcagaacagttt
aaaccagaatttttagcaattaaccccttccaccacattcctgctttggtagatgccggt
tttaatgtaatagagtctttagcaattttggactatttagaagttaaatatccaactcct
gtgatgttgccaaaagatgccgaagatttagcaattgtgcgaatggtggaaatagtcagt
gtgaatgaattattacctgctattactccactgatgtcagtaatattagatttaccagga
aaaaatgcagaagcaattgagcaagctaagacaaaaattagtacagcattgaattttttc
gagaatcaactggatgaccgtccctactttggcaacgagaacctaactttagctgaaatt
gtagcgggaagtattgtactctgggtgccaagagggggcatttacttagatgactatcca
acattaaaagcttggtacgatcacttagttccgcttccagcatag

DBGET integrated database retrieval system