Sciurus carolinensis (gray squirrel): 124960546 Help Entry 124960546         CDS       T08117                                  Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01523   Antifolate resistance ncar04010   MAPK signaling pathway ncar04014   Ras signaling pathway ncar04024   cAMP signaling pathway ncar04062   Chemokine signaling pathway ncar04064   NF-kappa B signaling pathway ncar04066   HIF-1 signaling pathway ncar04071   Sphingolipid signaling pathway ncar04137   Mitophagy - animal ncar04151   PI3K-Akt signaling pathway ncar04210   Apoptosis ncar04211   Longevity regulating pathway ncar04218   Cellular senescence ncar04380   Osteoclast differentiation ncar04613   Neutrophil extracellular trap formation ncar04620   Toll-like receptor signaling pathway ncar04621   NOD-like receptor signaling pathway ncar04622   RIG-I-like receptor signaling pathway ncar04623   Cytosolic DNA-sensing pathway ncar04625   C-type lectin receptor signaling pathway ncar04657   IL-17 signaling pathway ncar04658   Th1 and Th2 cell differentiation ncar04659   Th17 cell differentiation ncar04660   T cell receptor signaling pathway ncar04662   B cell receptor signaling pathway ncar04668   TNF signaling pathway ncar04722   Neurotrophin signaling pathway ncar04917   Prolactin signaling pathway ncar04920   Adipocytokine signaling pathway ncar04926   Relaxin signaling pathway ncar04931   Insulin resistance ncar04932   Non-alcoholic fatty liver disease ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar04936   Alcoholic liver disease ncar05010   Alzheimer disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05030   Cocaine addiction ncar05132   Salmonella infection ncar05133   Pertussis ncar05134   Legionellosis ncar05135   Yersinia infection ncar05140   Leishmaniasis ncar05142   Chagas disease ncar05145   Toxoplasmosis ncar05146   Amoebiasis ncar05152   Tuberculosis ncar05160   Hepatitis C ncar05161   Hepatitis B ncar05162   Measles ncar05163   Human cytomegalovirus infection ncar05164   Influenza A ncar05165   Human papillomavirus infection ncar05166   Human T-cell leukemia virus 1 infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05168   Herpes simplex virus 1 infection ncar05169   Epstein-Barr virus infection ncar05170   Human immunodeficiency virus 1 infection ncar05171   Coronavirus disease - COVID-19 ncar05200   Pathways in cancer ncar05202   Transcriptional misregulation in cancer ncar05203   Viral carcinogenesis ncar05207   Chemical carcinogenesis - receptor activation ncar05208   Chemical carcinogenesis - reactive oxygen species ncar05212   Pancreatic cancer ncar05215   Prostate cancer ncar05220   Chronic myeloid leukemia ncar05221   Acute myeloid leukemia ncar05222   Small cell lung cancer ncar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ncar05321   Inflammatory bowel disease ncar05415   Diabetic cardiomyopathy ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124960546    04014 Ras signaling pathway     124960546    04064 NF-kappa B signaling pathway     124960546    04668 TNF signaling pathway     124960546    04066 HIF-1 signaling pathway     124960546    04071 Sphingolipid signaling pathway     124960546    04024 cAMP signaling pathway     124960546    04151 PI3K-Akt signaling pathway     124960546  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     124960546   09143 Cell growth and death    04210 Apoptosis     124960546    04218 Cellular senescence     124960546  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124960546    04620 Toll-like receptor signaling pathway     124960546    04621 NOD-like receptor signaling pathway     124960546    04622 RIG-I-like receptor signaling pathway     124960546    04623 Cytosolic DNA-sensing pathway     124960546    04625 C-type lectin receptor signaling pathway     124960546    04660 T cell receptor signaling pathway     124960546    04658 Th1 and Th2 cell differentiation     124960546    04659 Th17 cell differentiation     124960546    04657 IL-17 signaling pathway     124960546    04662 B cell receptor signaling pathway     124960546    04062 Chemokine signaling pathway     124960546   09152 Endocrine system    04920 Adipocytokine signaling pathway     124960546    04917 Prolactin signaling pathway     124960546    04926 Relaxin signaling pathway     124960546   09156 Nervous system    04722 Neurotrophin signaling pathway     124960546   09158 Development and regeneration    04380 Osteoclast differentiation     124960546   09149 Aging    04211 Longevity regulating pathway     124960546  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124960546    05202 Transcriptional misregulation in cancer     124960546    05207 Chemical carcinogenesis - receptor activation     124960546    05208 Chemical carcinogenesis - reactive oxygen species     124960546    05203 Viral carcinogenesis     124960546    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124960546   09162 Cancer: specific types    05212 Pancreatic cancer     124960546    05221 Acute myeloid leukemia     124960546    05220 Chronic myeloid leukemia     124960546    05215 Prostate cancer     124960546    05222 Small cell lung cancer     124960546   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124960546    05170 Human immunodeficiency virus 1 infection     124960546    05161 Hepatitis B     124960546    05160 Hepatitis C     124960546    05171 Coronavirus disease - COVID-19     124960546    05164 Influenza A     124960546    05162 Measles     124960546    05168 Herpes simplex virus 1 infection     124960546    05163 Human cytomegalovirus infection     124960546    05167 Kaposi sarcoma-associated herpesvirus infection     124960546    05169 Epstein-Barr virus infection     124960546    05165 Human papillomavirus infection     124960546   09171 Infectious disease: bacterial    05132 Salmonella infection     124960546    05135 Yersinia infection     124960546    05133 Pertussis     124960546    05134 Legionellosis     124960546    05152 Tuberculosis     124960546   09174 Infectious disease: parasitic    05146 Amoebiasis     124960546    05145 Toxoplasmosis     124960546    05140 Leishmaniasis     124960546    05142 Chagas disease     124960546   09163 Immune disease    05321 Inflammatory bowel disease     124960546   09164 Neurodegenerative disease    05010 Alzheimer disease     124960546    05022 Pathways of neurodegeneration - multiple diseases     124960546   09165 Substance dependence    05030 Cocaine addiction     124960546   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124960546    05418 Fluid shear stress and atherosclerosis     124960546    05415 Diabetic cardiomyopathy     124960546   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     124960546    04932 Non-alcoholic fatty liver disease     124960546    04931 Insulin resistance     124960546    04933 AGE-RAGE signaling pathway in diabetic complications     124960546   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     124960546  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ncar03000]     124960546 Transcription factors [BR:ncar03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     124960546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  124960546 NCBI-ProteinID:  XP_047375326 EnsemblRapid:  ENSSCRG00010013411 LinkDB All DBs Position 11:10025796..10035438 Genome browser AA seq 552 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLCLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSTSISKPAPQPYTFTPSLSTINF DEFSPMVLPSGQISSQASALAPAPAPVLAQALVPAPAMPPPLAQAQAPAPGPVLAPGPPQ AVAPPAPKTTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLL NQGVSMPHPTAEPMLMEYPEAITRLVTGSQRPPDPAPTSLGTSGLPNGLAGDEDFSSIVD MDFSALLSQISS NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgttccccctcatcttcccctcagagccggcccaggcttctggtccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgtgagggc cgatcggcgggcagtattccaggagagagaagcacggataccactaagacccaccccacc attaagatcaatggttacacaggaccagggacagttcgcatctccctggtgaccaaggac cccccgcaccggcctcatccccatgaacttgtgggaaaggactgcagggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctgggaatccagtgt gtgaagaagcgggacctggagcaggcgatcagccagcgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgtggggactatgacctgaatgctgtgcggctctgc ttccaggtgacagtgcgagacccatcagggaggcctctctgcctaccgcctgtcctctct catccgatctttgacaaccgcgcccccaacactgctgagctcaaaatctgccgagtgaat cgaaactccgggagctgcctcggtggggacgagatcttcctgctatgtgacaaggtgcag aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtgcacaggcaagtggccattgtgttccggacccctccctatgcggacccc agcctgcaggctcctgtgcgtgtttccatgcaactgcggcggccttctgaccgggagctc agtgagcccatggaattccagtacctgccagacacagacgatcgtcatcgcattgaggag aagcgcaaaaggacatacgagacgttcaagagcatcatgaagaagagccctttcagtgga cccactgatccccggcctccaccccggcgcattgctgtgccttcccgcagttcaacttcc atctctaaaccagccccccagccctatacctttacaccatccctcagcaccatcaatttc gacgagttctcccccatggtattaccttctgggcagatctcaagccaggcctctgccttg gcaccagcccctgccccagtcttggcacaggccttggtcccagccccagccatgccacca cctctggctcaggcccaggccccagcccctggcccagtcctagccccaggccctccccag gctgtggccccacctgccccaaagaccacccaggccggggaaggcacgctgtcggaggcc ctgctgcacctgcagttcgatgctgatgaggacctgggggccctgcttggcaacagcacg gacccagccgtgttcacagacctggcatccgtggacaactcggagtttcagcagctgctg aaccagggtgtgtccatgccccaccccacagctgagcctatgctaatggagtaccctgag gccatcactcgcctggtgacaggttcccagaggccccctgacccagcgcccacctccctg ggaacctcggggctccccaacggccttgcaggggatgaagacttctcctccattgtggac atggacttctcagcccttttgagtcagatcagctcctaa

DBGET integrated database retrieval system