Sciurus carolinensis (gray squirrel): 124989538 Help Entry 124989538         CDS       T08117                                  Name (RefSeq) glutathione S-transferase A1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar00480   Glutathione metabolism ncar00980   Metabolism of xenobiotics by cytochrome P450 ncar00982   Drug metabolism - cytochrome P450 ncar00983   Drug metabolism - other enzymes ncar01100   Metabolic pathways ncar01524   Platinum drug resistance ncar05200   Pathways in cancer ncar05204   Chemical carcinogenesis - DNA adducts ncar05207   Chemical carcinogenesis - receptor activation ncar05208   Chemical carcinogenesis - reactive oxygen species ncar05225   Hepatocellular carcinoma ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     124989538   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     124989538    00982 Drug metabolism - cytochrome P450     124989538    00983 Drug metabolism - other enzymes     124989538  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124989538    05204 Chemical carcinogenesis - DNA adducts     124989538    05207 Chemical carcinogenesis - receptor activation     124989538    05208 Chemical carcinogenesis - reactive oxygen species     124989538   09162 Cancer: specific types    05225 Hepatocellular carcinoma     124989538   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124989538   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     124989538  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ncar02000]     124989538 Enzymes [BR:ncar01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      124989538 Transporters [BR:ncar02000]  Other transporters   Pores ion channels [TC:1]    124989538 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  124989538 NCBI-ProteinID:  XP_047415327 EnsemblRapid:  ENSSCRG00010008835 LinkDB All DBs Position 7:103142795..103156059 Genome browser AA seq 222 aa AA seqDB search MAGKPVLHYFNGRGRMESIRWLLAAAGVEFEEKFIESPDDLDKLKNDGSLMFQQVPMVEI DGMKLVQSRAILNYIATKYNLYGKDMKERVLIDMYTEGIADLLEMIMILPLCPADQKDAK LALIKDRSTNRYLPAFEKVLKSHGQDYLVGNKLSRVDIHLTELLYYVEEVDSSLLANFPL LKALKTKISNLPNVKKFLQPGSQRKPPPDPKKIEEMRKTFKF NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcaggaaagccagtgcttcactacttcaatggccggggcagaatggagtccatccgg tggctcttggcggcagctggagtggagtttgaagagaagtttatagaatctccagatgat ttggataagttaaaaaatgatgggagtctgatgttccagcaggtgcccatggtggagatc gatgggatgaagctggtgcagtccagagccattctcaactacattgccaccaaatacaac ctctacgggaaggacatgaaggagagagtcctgattgatatgtatacagagggtatagca gatttgcttgaaatgatcatgattctgccactatgtcctgcagatcagaaagatgctaag ttagccttgatcaaagacagatcaacaaaccgttacctccctgcctttgaaaaagtattg aagagccatggacaagactaccttgttggcaacaagctgagcagggttgacattcacctc actgaacttctctactatgtggaagaagttgactccagtcttctggccaacttccctctg ctgaaggccctgaaaaccaaaatcagtaacctccccaacgtgaagaaatttctgcagcct ggcagccagaggaagcctcctcctgacccgaaaaagatagaagaaatgaggaagacgttc aagttttaa

DBGET integrated database retrieval system