Notothenia coriiceps (black rockcod): 104945454 Help Entry 104945454         CDS       T04920                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc03010   Ribosome ncc04120   Ubiquitin mediated proteolysis ncc04137   Mitophagy - animal ncc04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:ncc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     104945454   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104945454  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104945454    04137 Mitophagy - animal     104945454  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ncc03011]     104945454    04121 Ubiquitin system [BR:ncc04121]     104945454 Ribosome [BR:ncc03011]  Ribosomal proteins   Eukaryotes    Large subunit     104945454   Archaea     104945454 Ubiquitin system [BR:ncc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    104945454 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 Ubiquitin_5 TBK1_ULD Sde2_N_Ubi OTU1_UBXL HATPase_c Dsc3_N Motif Other DBs NCBI-GeneID:  104945454 NCBI-ProteinID:  XP_010769428 UniProt:  A0A6I9N1L9 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctcaccggaaagaccatcactctggaggttgagcccagt gatagcatagagaacgtgaaggccaagatccaggacaaggagggaatccccccagatcag cagaggttgatctttgctggcaagcagctggaagatggccgcaccctctctgactacaac atccagaaggagtccaccctccatcttgtgctccgtctccgtggaggaaactaa

DBGET integrated database retrieval system