KEGG   Neurospora crassa: NCU00549Help
Entry
NCU00549          CDS       T01034                                 

Definition
(RefSeq) glutathione transferase omega-1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ncr  Neurospora crassa
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCU00549
Enzymes [BR:ncr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCU00549
Transporters [BR:ncr02000]
 Other Transporters
  Pores ion channels [TC:1]
   NCU00549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I
AA seq 373 aa AA seqDB search
MLPICIPLPDRNPKLDTLLSALTYLHVPTLSKLPRTLSSSIRTPFVRKLNTRSPPVPLQV
HHCTMFSASSSNPSTQKPASVDTSLQGSPTGAAALFASSHSSPHPLKLYGGWFCPFVQRV
WITLAEKNIPHQYIEINPYHKAPEFLALNPRGLVPTLAVPTSTDPKTGKVKEVKPLYESL
VLCEYLDEAYADENVYGDRLLPQDDAYERARCRLWIDHISSRVVPAFYRFIQHTPDKPYT
IDEIRTEFHGHLKAFAKEMLHASSPSSSPGPFFLGDKFSLVDIMLAPWAKRLFLIDHYKP
GGVGIPPSGQRGSEVDEEIWKRWEEWYKAVTERESVKKTWSEDEQYVGAYKRYAEDTTQS
EVGRATRSGRGLP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccatatgtatcccactaccggacaggaaccccaagcttgataccctcctctcc
gcattgacctacctccatgtgccaacgctttccaagctcccgcgaactctcagctcctcc
atcagaaccccatttgtccggaagctcaacacaagatcgcccccggtcccccttcaagtc
caccattgtaccatgttctccgcctcttcctctaacccctccacccaaaagccggcttcg
gtcgacacctccctccaaggctcgcccaccggcgccgccgcgctcttcgcttcctcgcac
tcttctccacaccccctcaagctctacggcgggtggttctgtccctttgtccagcgagtc
tggatcaccctcgccgagaaaaacattccgcaccaatacatcgagatcaacccgtaccac
aaagcgcccgagttcctcgctctgaacccacggggtcttgtgcccaccctcgcagtcccc
acctccaccgaccccaagaccggaaaggtgaaggaggtcaagcccttgtacgagagcttg
gtgctttgcgagtacttggatgaggcgtatgcggatgagaacgtgtacggggaccgactc
ctcccgcaagacgacgcctacgaaagggcgaggtgcagactgtggatcgaccatatctct
tcgagggtggtgccggctttttaccggtttattcagcacacccccgacaaaccctacacc
atcgacgagatccgaaccgagttccatggacacctgaaagcgttcgctaaagaaatgctt
catgcctcttccccttcttcctccccaggccccttcttcctaggcgacaagtttagtcta
gtagacataatgctagcgccttgggcgaagcggttattcctgattgatcactacaaacca
ggcggagtcgggatccctcccagtggtcagaggggaagtgaggtggatgaggagatttgg
aagaggtgggaggagtggtataaggctgtgacggagagggagagtgttaagaagacgtgg
agcgaggatgaacagtatgtgggcgcgtataagaggtatgcggaggacacgacacagagt
gaagtggggagggcgacgaggagtgggaggggtttaccttga

DBGET integrated database retrieval system