KEGG   Naumovozyma dairenensis: NDAI_0H03510Help
Entry
NDAI_0H03510      CDS       T02234                                 

Gene name
NDAI0H03510
Definition
(RefSeq) hypothetical protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
ndi  Naumovozyma dairenensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NDAI_0H03510 (NDAI0H03510)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NDAI_0H03510 (NDAI0H03510)
Glycosyltransferases [BR:ndi01003]
 Polysaccharide
  Storage polysaccharide
   NDAI_0H03510 (NDAI0H03510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8:856049..858187
Genome map
AA seq 712 aa AA seqDB search
MTRDLKEHLLFEIATEVANRVGGIYSVLKSKAPITVAQYKENYMLLGPLNKATYQNEIEQ
LDWTSEEAFSGDLKPIQDTLHSLQSKGFNFVFGRWLIEGSPKVLLIDLDSIRWRLNEWKA
DLWSLVGIPSPEYDSETNDAILLGYAVVWFLGELTQLDHKHAIIAHFHEWLAGVALPLCR
KKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLANFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKEKINEFVRGH
FHGCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVAGSKMTVVAFIIMPAK
TNSFTVEALKSQAVVKSLENTVDEVTKNIGKRIFEHAMRFPHMGITSEIPTDLNELLKPS
DNVLLKRRVLGLRRADGQLPPVVTHNMVDDANDPILNQIRHVQLFNNTSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IEANQAKDYGIYIVDRRFKNPDESVEQLVDCMEEFCKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPDQFKQLVGEELNDTDMNTLAGGKKLKIARPLSVPGSPREPR
SGSTVFMTPGDLGTLQDANNADDYFNLSMDGRALDTDDTEEDEGIAGVDGPH
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgacttgaaagaacatttattgttcgaaattgcaacagaagtcgccaacaga
gttggtggtatctattctgtcttaaaatccaaagcaccaataacagtagctcaatacaag
gaaaattacatgttattaggtcccctaaacaaggcgacttaccaaaatgaaatcgaacaa
ttagattggacctcagaggaggcattctctggtgatttgaaacccatccaagacactctc
cattctttacaatctaagggattcaatttcgtctttggtcgttggttaattgaaggttct
ccaaaggttctattaatagatttggattctattagatggcgtttaaatgaatggaaagct
gatctttggtcattagttggtatcccatctcccgaatatgattctgaaactaatgatgct
atcttattagggtatgctgtcgtttggttccttggtgaattgactcaattagatcataaa
catgctattattgctcatttccatgaatggttagcaggtgttgcattgcccttgtgcaga
aagaagagaattgatgtcgttaccatttttacaactcatgctactttgttaggtagatat
ttatgtgctgctggtgatgttgacttttataataatttagcaaactttgatgttgatcaa
gaagccggtaaaagaggtatttatcatagatattgtattgaaagagctgctgcgcacact
gctgatgtgtttactacagtttcacaaattactgcctttgaagctgaacatcttttgaaa
agaaaacctgatgggattttaccaaatgggttaaatgttgttaaattccaagccgttcat
gaattccagaatttacatgctttgaaaaaggaaaagatcaatgaattcgttagaggtcat
ttccatggttgtttcgattttgatttggataatactttatatttctttatcgctggtaga
tacgaatataaaaataaaggtgccgatatgtttattgaagcattggctcgtttgaattat
agattaaaagttgctggttccaagatgacagtggttgctttcattattatgcctgctaag
acaaactcattcaccgtggaagccttaaagagtcaagctgtagttaaatcattggaaaat
acagtggatgaagttactaaaaacattggtaagagaatatttgaacatgcgatgagattt
cctcatatgggcattacatcagaaatcccaacagatttgaatgaactattaaaaccatct
gataatgttttgttaaagagacgtgtcttgggattaagaagagctgatggccaattacca
ccagtggttactcataacatggttgatgatgctaatgatccaatcttaaatcaaattaga
catgttcaattgtttaataatacaagtgatagagttaaagttattttccatcctgaattt
ttgaatgctaataatccaatcttaggtttagattatgacgaatttgttcgtggttgtcat
ttaggtgtttttccttcatattatgaaccatggggttatactccagctgaatgtaccgtt
atgggtgttccatcaattaccaccaacttatcagggttcggtgcttacatggaagacttg
attgaggctaatcaagctaaagattatggtatttacatcgttgatcgtagatttaagaac
cctgatgaatctgtggaacaattagttgattgtatggaagaattctgtaagaaaacaaga
agacaaagaatcaaccaaagaaatagaacagaaagattatcagatctattagattggaaa
cgtatgggtttagaatatgttaaggcaagacaactagcattacgtagagcatatccagat
caatttaaacaattagttggagaagaattgaacgataccgatatgaatactttagctggt
ggtaagaaattaaagattgctagaccattaagtgtgcctggttcaccaagggaaccaaga
tcaggcagtacagtgttcatgactcctggtgatttaggtactttacaagatgccaacaat
gctgatgattatttcaatttaagtatggatggtagagctcttgatactgatgatacagaa
gaagatgaaggtattgctggtgtagatggacctcattaa

DBGET integrated database retrieval system