KEGG   Nocardioides dokdonensis: I601_1969Help
Entry
I601_1969         CDS       T04431                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00473  D-Alanine metabolism
ndk01100  Metabolic pathways
ndk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ndk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    I601_1969 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    I601_1969 (alr)
Enzymes [BR:ndk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     I601_1969 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ndk01011]
 Precursor biosynthesis
  Racemase
   I601_1969 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANH38398
UniProt: A0A1A9GJF7
LinkDB All DBs
Position
2056141..2057304
Genome map
AA seq 387 aa AA seqDB search
MSLLPPHVARRAEIVVDLAAIRHNVRLLAGEIGPDVALMVVVKADGYGHGMAQVAAAARE
AGAPWLGVATFDEALALRAAGDTGRLLAWLTVPGEDWAPVVAADVDVTAYSLADLDQLVD
AVARAGRPARLQLKIDTGLRRGGSLPADWPALVAAARAGEEAGHWRVTGIWSHPASADDP
AHPANDAQEQVFRDALATAEEAGLRPEVRHIANSAATLLRPSMHFDLVRVGIATYGLDPA
PGHTRDLGLRPAMSVEATLAMTKRLAPGDGVSYGHTWVADAPVTVGLVPTGYADGVPRHA
GNTAHIGVAGVRRPVRGRICMDQLVVEVAGEGEEPAVGAGDRVVLFGSAPDPTAQDWAEA
CDTISYEIVSRIGGRFVRRWTDSERDS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgcccccacacgtcgcccggcgtgccgagatcgtcgtcgacctggcggcg
atccggcacaacgtgcgcctgctggccggcgagatcgggcccgacgtggccctgatggtc
gtggtcaaggccgacggctacggccacgggatggcccaggtggccgcggcggcccgcgag
gccggagccccctggctcggcgtggccaccttcgacgaggcgctggcgctgcgcgccgcc
ggcgacaccggccgcctgctggcctggctcaccgtgcccggtgaggactgggcgcctgtg
gtggccgccgacgtcgacgtgacggcgtactcgctcgccgacctcgaccagctcgtcgac
gcggtcgcccgcgccggtcgccccgcccggctgcagctcaagatcgacaccggcctgcgc
cgcggcggctcgctgcccgccgactggccggccctggtcgccgccgcccgcgccggggag
gaggcgggccactggcgagtcaccggcatctggtcgcaccccgcctcggccgacgacccc
gcgcaccccgccaacgacgcccaggaacaggtcttccgcgacgcgctggccaccgcggag
gaggccgggctgcgccccgaggtgcgtcacatcgccaactccgccgccaccctgctgcgc
ccctcgatgcacttcgacctcgtccgggtcggcatcgcgacctacggcctcgaccccgcc
cccggccacacccgcgacctgggcctgcgccccgcgatgagcgtggaggcgacgctggcg
atgaccaagcggttggcccccggcgacggggtctcctacggccacacctgggtcgccgac
gcgccggtcaccgtcggcctggtcccgaccgggtacgccgacggcgtgccgcgccacgcc
ggcaacaccgcccacatcggggtcgccggcgtacgccgaccggtgcgcggccggatctgc
atggaccagctggtcgtcgaggtggccggcgagggcgaggagccggcggtgggggcgggg
gaccgggtggtgctcttcggcagcgcccccgacccgaccgcgcaggactgggccgaggcc
tgcgacacgatctcctacgagatcgtcagccggatcggcggccgcttcgtgcggcgctgg
accgacagcgagcgggactcgtga

DBGET integrated database retrieval system