KEGG   Nocardia farcinica IFM 10152: NFA_1210Help
Entry
NFA_1210          CDS       T00207                                 

Gene name
sodF
Definition
(GenBank) putative superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nfa  Nocardia farcinica IFM 10152
Brite
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NFA_1210 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAD54963
NIH_Japan: nfa1210
UniProt: Q5Z3M8
LinkDB All DBs
Position
complement(111687..112307)
Genome map
AA seq 206 aa AA seqDB search
MAEYTLPDLDYDYSALEPHISGQINELHHSKHHAAYVAGANQALEKLEAARESGDHSAIF
LYEKNLAFHLGGHVNHSIWWKNLSPNGGDKPVGELAAAIDDQFGSFDKFRAQFTAAANGL
QGSGWAVLGYDTLGQKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVTA
FWNVVNWADVQDRFARAVNQGKGLVF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtacacgctgccagatctggactacgactacagcgctctggagccccacatc
tccgggcagatcaacgagctccaccactccaagcaccacgccgcctacgtcgccggtgcc
aaccaggcgctggagaagctggaggccgcccgggagtccggcgaccacagcgccatcttc
ctgtacgagaagaacctggccttccacctcggtggccacgtcaaccactcgatctggtgg
aagaacctgtccccgaacggcggtgacaagccggtcggtgagctcgccgccgcgatcgac
gaccagttcggctcgttcgacaagttccgcgcgcagttcaccgccgcggccaacggcctg
cagggctcgggctgggcggtgctgggctacgacacgctgggccagaagctgctgaccttc
cagctctacgatcagcaggccaacgtgccgctcggcatcatcccgctgctgcaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtgaccgcg
ttctggaacgtggtgaactgggccgacgtgcaggatcgcttcgcccgcgccgtgaaccag
ggcaagggcctggtcttctga

DBGET integrated database retrieval system