KEGG   Nocardia farcinica IFM 10152: NFA_35400Help
Entry
NFA_35400         CDS       T00207                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NFA_35400
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NFA_35400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFA_35400
   00430 Taurine and hypotaurine metabolism
    NFA_35400
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NFA_35400
Enzymes [BR:nfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NFA_35400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NIH_Japan: 
UniProt: 
LinkDB All DBs
Position
3750791..3752206
Genome map
AA seq 471 aa AA seqDB search
MPLSHPSFPQDPGPSEVAVNPVFTREPVSVPRDRLPAGELDADIAYQVVHDELMLDGNAR
LNLATFVTTWMEPSARVLMAECFDKNMIDKDEYPRTADLEQRCVRMLADLWHAADPAHAT
GCSTTGSSEACMLAGLALKRRWQHRRRAAGLSTERPNLVMGANVQVCWEKFADYWDVEAR
LVPMAGDRFHLTAEAALPHCDENTIGVVAVLGSTFDGSYEPVAEICAALDELERQRGWDI
PVHVDGASGAMVAPFCDPDLVWDFRLPRVASVNTSGHKYGLVYPGVGWVVWRDAAALPED
LIFRVNYLGGQMPTFALNFSRPGAQVVAQYYTFLRLGRSGYTRVQQYCRDVATRLADRIA
ALGAFRLLTDGRQLPVFAFTLAEGETGYSVFDVSAALREQGWLVPAYTFPADREDLAVLR
IVVRNGFSHDLADMLLDALAAVLPRLRAQDRPQHGPDTATFAHGAQAPSGH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgtcgcacccctcctttccgcaggatcccgggccgagcgaggtggccgtcaat
cccgtcttcacccgcgaaccggtgtcggtgccgcgggatcggctacccgcgggcgaactc
gacgccgatatcgcctaccaggtggtgcacgacgagttgatgctcgacggcaacgcccgg
ctgaacctggccaccttcgtcaccacgtggatggagccgagcgcgcgggtgctcatggcg
gagtgcttcgacaagaacatgatcgacaaggacgaatacccgcgcaccgccgacctcgag
cagcgctgcgtgcgcatgctcgccgacctctggcacgctgccgatcccgcccacgccacc
ggctgttcgaccaccggttccagcgaggcgtgcatgctggccgggctggcgttgaaacgg
cgctggcagcaccggcgccgggcggccgggttgtccaccgagcgcccgaatctggtgatg
ggagccaatgttcaggtctgctgggagaagttcgccgactactgggatgtggaagccagg
ctggtgccgatggcgggcgaccgcttccacctgaccgcggaggcggcgctgccgcactgc
gacgagaacaccatcggcgtggtcgcggtgctcggctcgaccttcgacggcagttacgaa
ccggttgccgagatctgcgccgcgctcgacgagctggaacggcagcgcggctgggacatc
ccggtgcacgtcgacggcgcctccggcgcgatggtcgcgccgttctgcgacccggatctg
gtgtgggacttccggttgccgcgggtcgcctccgtcaacacctccgggcacaagtacggg
ctggtgtaccccggggtgggctgggtggtgtggcgcgacgccgcggcgttgccggaggac
ctcatcttccgggtcaactacctcggcggccagatgcccaccttcgcgctgaacttctcc
cgcccgggcgcgcaggtcgtcgcccagtactacaccttcctgcggctgggtcgcagcggc
tacacgcgggtccagcagtactgccgcgacgtggcgacccgcctcgccgaccggatcgcc
gccctgggcgcgttccggttgctcaccgacggccgccagctgccggtcttcgcgttcacc
ctcgccgagggcgaaaccggctactcggtgttcgacgtctccgccgcgttgcgcgaacag
ggttggctggtgcccgcctacacctttcccgccgaccgcgaggatctggccgtcctgcgc
atcgtggtccgcaacggattcagccacgacctggccgacatgctgctcgacgccctggcc
gccgtcctcccccgcctgcgcgcccaggaccggccccagcacggcccggacaccgccacc
ttcgcccacggcgcccaggccccgagcggccactga

DBGET integrated database retrieval system