KEGG   Nocardia farcinica IFM 10152: NFA_9720Help
Entry
NFA_9720          CDS       T00207                                 

Gene name
glpD
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00564  Glycerophospholipid metabolism
nfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NFA_9720 (glpD)
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NFA_9720 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 3HCDH_N NAD_binding_8 Pyr_redox Lycopene_cycl GIDA Thi4
Motif
Other DBs
NCBI-ProteinID: BAD55817
NIH_Japan: nfa9720
UniProt: Q5Z174
LinkDB All DBs
Position
1073596..1075329
Genome map
AA seq 577 aa AA seqDB search
MTKRPQSQCLGPEQRRTAWERLGKEHFDVVVVGGGVVGAGIALDAATRGLDVALVEARDL
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELALSTLSPHLVKPLRFLYPLTHRGW
ERPYVASGLVLYDTMGGAKSVPGQRHLTRHGALRLAPGLRRDALIGGVSYYDTVVDDARH
TMTVARTAAHYGAVIRTSTQVVGFLREADRVVGVKIRDTEDGRTGEVRAHVVINATGVWT
DEVQALSQTRGRFHVRASKGVHVVVPRDRIVSDTALILRTATSVLFVIPWGAHWIIGTTD
TDWNLDLAHPAATKADIDYLLDRVNQVLVTPLTHDDITGVYAGLRPLLAGESDSTSKLSR
EHAVARIAPGLVAIAGGKYTTYRVMAYDAVDEAAQDIPARVSPSITEKVPLLGADGYFAL
VNQTVQLAEMYGVHPYRIKHLLDRYGSLIDEVMVLAQDRPELLQPITAAPSYLRVEAVYA
AAAEGALHLDDILARRTRISIEYAHRGADCAEEVARLVAPVLGWDEAEIEREIDTYRSRV
EAEVRSQTQPDDASADALRIAAPEPRPQILEPVPSEG
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagagaccgcaatcgcagtgcctcggccccgagcagcgccgcacggcctgggag
cgactcggcaaggagcatttcgacgtggtcgtcgtgggcggcggcgtggtcggcgcgggc
atcgcgctggacgcggccacccgcggcctggacgtggcgctggtggaggcacgtgacctc
gcctccggcacgtcgagccgctcgtcgaagatgttccacggcggcctgcgctatctcgag
cagttggaattcggcctggtgcgcgaggcgctgcgcgagcgcgagctggcgctgtcgacg
ctctcgccgcacctggtgaagccgctgcggttcctctacccgctgacccatcgcggctgg
gagcggccgtacgtggcctcgggcctggtgctctacgacaccatgggcggcgccaaatcc
gttcccgggcaacgccacctgaccaggcacggcgcgctgcggctggcacccggcctgcgc
cgcgacgcgctgatcggcggggtgagctactacgacaccgtggtcgacgacgcccgccac
accatgaccgtggcgcgcaccgccgcccactacggcgcggtcatccgcacctccacccag
gtggtcgggttcctgcgggaagccgaccgggtggtcggggtgaagatccgcgacaccgag
gacgggcgcaccggcgaggtcagggcgcacgtggtgatcaacgccacgggggtgtggacc
gacgaggtgcaggcgctctcgcagacccgcggccggttccacgtgcgcgcgtccaagggt
gtgcacgtggtggtgccgcgcgaccggatcgtcagcgacaccgcgctgatcctgcgcacc
gcgacctcggtgctgttcgtcatcccgtggggcgcgcactggatcatcggcaccaccgac
accgactggaacctggatctggcgcacccggccgccaccaaggcggacatcgactacctg
ctggaccgggtgaaccaggtgctggtcaccccgctgacccacgacgacatcaccggtgtg
tacgccgggttgcgcccgctgctggccggggagagcgattcgacctccaagctgtcgcgc
gagcacgccgtggccaggatcgcgcccggcctggtggccatcgcgggcggcaagtacacc
acctaccgggtgatggcctacgacgcggtcgacgaagccgcgcaggacatcccggcgcgg
gtgtcgccctcgatcaccgagaaggtgccgctgctgggcgccgacggctatttcgcgctg
gtgaaccagaccgtgcaactcgccgagatgtacggcgtgcacccgtaccggatcaagcac
ctgctcgatcgctacggctcgctgatcgacgaggtgatggtgctggcccaggaccgcccg
gagctgttgcagccgatcaccgccgcaccgtcctatctgcgggtggaggcggtgtacgcc
gcggcggccgagggcgcgctgcacctggacgacatcctggcccggcgcacccgcatctcc
atcgagtacgcccaccgcggcgcggactgcgccgaggaggtcgcgcggctggtcgcgccg
gtgctcggctgggacgaggccgagatcgagcgcgagatcgacacctaccgctcccgggtg
gaggccgaggtccggtcgcagacccagcccgacgacgcctccgccgacgcgctgcgcatc
gccgcgcccgagccgcgcccgcagatcctcgaaccggtgccgagcgagggctga

DBGET integrated database retrieval system