KEGG   Nocardia farcinica NCTC11134: ERS450000_04120Help
Entry
ERS450000_04120   CDS       T04524                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nfr  Nocardia farcinica NCTC11134
Brite
Enzymes [BR:nfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ERS450000_04120 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
p2:635366..635986
Genome map
AA seq 206 aa AA seqDB search
MAEYTLPDLDYDYSALEPHISGQINELHHSKHHAAYVAGANQALEKLEAARESGDHSAIF
LYEKNLAFHLGGHVNHSIWWKNLSPNGGDKPVGELAAAIDDQFGSFDKFRAQFTAAANGL
QGSGWAVLGYDTLGQKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVTA
FWNVVNWADVQDRFARAVNQGKGLVF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtacacgctgccagatctggactacgactacagcgctctggagccccacatc
tccgggcagatcaacgagctccaccactccaagcaccacgccgcctacgtcgccggtgcc
aaccaggcgctggagaagctggaggccgcccgggagtccggcgaccacagcgccatcttc
ctgtacgagaagaacctggccttccacctcggtggccacgtcaaccactcgatctggtgg
aagaacctgtccccgaacggcggtgacaagccggtcggtgagctcgccgccgcgatcgac
gaccagttcggctcgttcgacaagttccgcgcgcagttcaccgccgcggccaacggcctg
cagggctcgggctgggcagtgctgggctacgacacgctgggccagaagctgctgaccttc
cagctctacgatcagcaggccaacgtgccgctcggcatcatcccgctgctgcaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtgaccgcg
ttctggaacgtggtgaactgggccgacgtgcaggatcgcttcgcccgcgccgtgaaccag
ggcaagggcctggtcttctga

DBGET integrated database retrieval system