KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726570Help
Entry
103726570         CDS       T03372                                 

Gene name
Tgm5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103726570 (Tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 724 aa AA seqDB search
MAQGCPIEGLEVALVDLQSSRNNVRHHTEEISIERLIVRRGQAFVITLYFRNRGFQPGLD
NIIFVAETGPLPDLAKGTRAVFSLTSSDGPSPWIASLETNGAASLEVSLCAPPMAAVGRY
LLKIRVDSFQGAVTAYQLGEFILLFNPWCPADGVYLDSEPQRQEYIVNDYGFIYQGNKSW
IRPCPWNYGQFEENIIDICLELLQKSLNFQVDPSTDCALRGSPVYISRVVCAMINSNDDN
GVLNGNWSENYTDGVNPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIP
TRVITNFDSGHDTDGNLIIDEYYDSTGRILENMKKDTVWNFHVWNECWMARKDLPPGYGG
WQVLDATPQETSNGLYCCGPASVRAIKEGEVDLNFDTRFAFSMVNADCMSWLVYGGKEQK
LHQDTAAVGNFISTKSIQSDERDDITESYKYEEGSLQERQVFLKALQKLKDGRSQGPHRA
DTTPFSSMPPGQDNPRSLDTPSLQPSDVMQVSLKFELLDLPNMGQDINFVLLALNMSPQF
KDLKVNLSAQSLLHDGSPLTPFWQDIAFITLFPQEEKTYPCKILYSQYNQYLSTDKLIRI
SALGEEKSTPEKILVNKIITLTFPGIVINVLGTAFVNQPLTIQVIFSNPLSEPVEDCVLT
LEGSGLFKKQQRILVGVLKPHHKASITLKTVPFKSGQRQIQANLRSNKFKDIKGYKNVYV
DFGL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggctgccctattgaagggctggaagtggccctcgtagacctccagagctcc
cggaacaatgtacgacaccacacagaagagatcagcattgaacgccttattgtccgccgg
ggccaggcctttgtcatcaccttatactttaggaaccggggcttccagccaggcctggac
aacatcatctttgtggctgagactggacctctaccagacctggctaaagggactcgggca
gtgttcagcttgacaagcagtgatggcccaagtccctggatcgcttccttggagaccaat
ggggccgcctccctggaagtgagcctgtgcgcccctcccatggcagcggtgggtcggtac
ctcttgaaaattcgcgttgactccttccagggcgctgtcacagcctaccagctgggggag
ttcatcctgctcttcaatccctggtgtccagctgatggtgtctacttggacagtgagcct
cagaggcaggagtatattgtgaatgattatggcttcatctaccaaggaaacaagagttgg
atccgcccatgcccctggaactatgggcagtttgaggaaaatatcatagacatctgtctg
gagctgctacagaagagcctgaacttccaggttgacccatccacagactgtgccctgcgg
ggaagccccgtctacatcagcagagtggtgtgtgccatgatcaacagcaacgatgacaac
ggggtgcttaatggaaactggagtgagaattacacagatggtgtcaaccctgcagagtgg
acaggcagcgtggccatcctgaagcagtggcacgccacaggctgccagccagtacgctat
gggcagtgctgggtctttgctgccgtcatgtgcacagtgatgaggtgcctggggatcccc
acccgtgtgatcaccaactttgactccggccatgacacagacgggaacctgattatagat
gagtattatgacagcacaggcaggattttggagaatatgaagaaggataccgtctggaat
ttccatgtatggaatgagtgctggatggcacgtaaggacctccctcctggatatggaggc
tggcaggtgctggatgccacacctcaggaaaccagcaatggtctctactgctgcggtcct
gcctctgtcagagcaatcaaagaaggagaagtcgatctgaacttcgacacacgctttgca
ttttccatggtcaatgcagactgcatgtcctggctagtttatggagggaaggagcagaaa
cttcaccaggatacagctgctgttggtaactttatcagcactaagagcatccagagtgac
gagcgggatgacatcacagagagctacaagtatgaagaaggttcccttcaagagaggcag
gtgtttctaaaggctctgcagaagctaaaggatggaaggtctcaaggtcctcaccgagca
gacacgacacccttcagttccatgccaccagggcaggacaaccctcggagcctggataca
ccttcccttcaacccagtgacgttatgcaggtctccctgaaatttgagctactcgaccta
cccaacatgggccaggacataaactttgtcctgttggctctcaatatgtcacctcagttc
aaggatctcaaagtaaacctgagtgcccagtccctgttgcatgatggcagccccctgacc
ccattctggcaggacatagcattcatcacattgtttcctcaagaagaaaagacctaccct
tgtaaaatcctctactctcagtacaaccagtatctgtcgacagacaagctaatccgcatc
agtgccctgggcgaagagaagagcactcctgagaaaatcctggtgaacaagatcatcacc
ttgactttcccaggcatcgtgattaatgttctaggaacagcctttgtgaatcagccactc
actatccaggtgatattttcaaacccactctcagagccagttgaggactgtgtgctgacc
ttggaaggaagcggcctctttaagaagcaacagagaatcctcgttggagtcctcaagccc
catcacaaagccagcatcactctgaagacagtcccttttaagagtggccaaaggcagatc
caagctaatctgaggagcaacaagtttaaggacatcaagggttacaagaatgtatatgta
gactttgggttataa

DBGET integrated database retrieval system