KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH32250Help
Entry
RG1141_CH32250    CDS       T03208                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ngl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    RG1141_CH32250
Enzymes [BR:ngl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RG1141_CH32250
DNA repair and recombination proteins [BR:ngl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RG1141_CH32250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3196679..3199210
Genome map
AA seq 843 aa AA seqDB search
MALETYNQKRNFKVSPEPQGKVSGGRKAKASGNSFVIQKHDATRLHYDFRLELDGVLKSW
AVTRGPSFVPGEKRLAVHVEDHPLDYGGFEGMIPKGNYGAGAVLLWDRGTWDPIGDPHKG
YKKGHMEFELKGEKLEGRWHLIRMARREGEKRENWLLVKGEDEFARAEGDKDILDEMPLS
VKSGKTLDEIWGRKAPTGRSAGKPKAKTKSDPGREKSDIAASKIKGARKAELPDFVEPQL
ATLVKSAPSGKRWVHEIKLDGYRLQARIENGKVKLLTRTGLDWTHKFGDEIIAEFGKLSP
ADAIIDGEVAVEAGSGATDFSLLQQDLSEGRDDRFTFYAFDLLHLDGYDLTGATLLKRKE
ALETLLTGSGPALRFSEHFSDEGGLVLKHACRLSLEGIISKISDAPYRPGRGRDWVKSKC
SARQEFVIAGFVPSSVSRTAIGSLVMGYYDKGKLRHAGRVGTGYSNAMAQSLFKRLQEIQ
TGESPFDEKLAGVEKKDVVFVRPELVAEVEFRGWTADAHIRHAAFRGLREDKDPKDIVRE
GGPVNAAEQPKPPKRTVNLTHPDRVYWPDAGVTKAGLADYYTEVWRLMAPFVVNRPLALV
RGPDGIGKPLFFQKHGWKGMTKNAVLVKDPTDPAEEDITIRDLDGLLGLVQGATLEIHPW
GSTLDDWEKPDMVNIDLDPGEGVSWTDIIAAAHEVKRRFEDMGLVAFVKTSGGKGLHVVA
PVKPKAEWPEVKAAMKALADGMAGDDPDKYVSTITKSKRSGKILIDYLRNGRGNTAVAPY
STRARPGAPVSMPVEWDELGGAIGPNYFTAINAPARIAQQTSDPWGDFRKAEAPIEFKAK
KKR
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaaacctataatcaaaagcggaatttcaaggtgtccccggagcctcaagga
aaggtctccggcggccgcaaggccaaggcatccggcaacagtttcgtgatccagaagcac
gacgccacccggctgcattacgatttccggctggaactggacggtgtgctgaaaagctgg
gccgtgacccggggcccaagtttcgttcccggcgaaaagcggctggcggtgcatgtggaa
gaccatccgctcgattacggtggtttcgaaggcatgatccccaaaggcaattacggcgcc
ggcgcggtgctgctgtgggaccgcggcacctgggatccgatcggcgatccacacaagggt
tataagaaaggccatatggaattcgagttgaagggcgagaagctggagggccgctggcac
ctgatccgcatggcccgcagagagggcgaaaaacgcgagaactggctgctggtgaaaggc
gaggacgaattcgcccgcgcagagggcgacaaggacattctcgacgaaatgccgctttcg
gtaaagtcaggcaagacactggacgaaatctggggccgcaaagcgccgacgggaaggagt
gctggcaaaccgaaggcgaagacgaaatccgatcccggacgggaaaaatccgacatcgct
gcctcgaagatcaagggcgccaggaaagccgaactcccggatttcgttgagccgcagctt
gcgacgctggtgaagagcgcgccctccggcaaacgctgggtccacgagatcaagctcgac
ggctatcgcctgcaggcccgtatcgaaaatggcaaggtaaagctgttgacgcgcaccggg
ctggattggacgcataagttcggagacgagatcatcgcggaattcggaaagcttagcccg
gccgatgcgattatcgatggggaagtagcggtcgaggccggttccggcgccaccgatttc
tccctgctccagcaggacctgagcgaaggccgggacgaccggttcaccttctacgcattc
gacctgttgcatctcgacggttacgacctgaccggcgcgacgcttctgaagcgcaaggag
gcgctggaaacactgctaaccggcagcggcccggccttgcgcttcagcgagcattttagc
gacgaaggcggtctggtcctgaaacatgcctgccggctgagcctcgaaggcatcatttcc
aagatatcggatgcgccctatcgccctggccgcggccgcgactgggtgaagtcgaaatgt
tcggctcgacaggaattcgtgatcgccggatttgtcccctcctccgtttcgaggacggcg
atcggatcgctggtcatgggatattacgacaagggaaaactgcggcatgccggtcgcgtc
ggcaccggttattcgaatgccatggcgcaatcgctcttcaagcgcctccaggagatccag
actggcgaaagcccgtttgacgaaaagctcgcgggggtggaaaagaaggacgtcgttttc
gtgcggcccgagctggtggcagaagtggaatttcgcggctggacggcggatgcgcatatc
cgtcacgccgccttccggggcttgcgcgaagacaaggatccgaaggatatcgtccgggag
ggcggacctgtgaatgcagcggaacaaccgaagccaccgaaacggacagtcaatcttacc
catccggaccgggtctactggccagatgccggtgtgaccaaggccgggcttgcagattat
tacaccgaagtctggcggctgatggcgcccttcgtcgtcaaccgcccgctggccctggtg
cgtgggccggatgggatcggtaaaccgctcttcttccagaaacatggctggaagggcatg
accaagaacgccgtgcttgtgaaggaccccaccgatccggcggaagaggatatcaccatc
cgcgacctcgatggattgctcggcctcgtccaaggggcaacgctggaaatccatccctgg
ggctcgacgcttgacgactgggaaaagccggacatggtcaatatcgacctcgacccggga
gaaggcgtctcctggaccgatatcatcgctgccgctcatgaggtgaagcgccgtttcgag
gacatggggctggtggccttcgtcaagacctcgggcggcaagggcctgcatgtcgtcgca
ccggtcaaaccaaaggcagaatggccggaggtgaaggcggcgatgaaggcgctcgccgac
ggcatggccggcgacgaccccgacaaatatgtatcgacgatcaccaagtcgaagcgaagc
ggcaagatcctcatcgactacctgcgcaacggtcgcggcaatactgccgtcgccccctat
tccacccgtgcccgccccggcgcaccggtttccatgccggtcgagtgggacgaactcggc
ggcgcgatcggccccaactatttcacggccatcaacgccccggcgcgcatcgcccagcag
acgagcgatccgtggggagattttcgcaaggcggaagccccgatcgagttcaaggcaaag
aagaaacggtag

DBGET integrated database retrieval system