KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_PA08080Help
Entry
RG1141_PA08080    CDS       T03208                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RG1141_PA08080
   00650 Butanoate metabolism
    RG1141_PA08080
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RG1141_PA08080
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RG1141_PA08080
Enzymes [BR:ngl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RG1141_PA08080
Amino acid related enzymes [BR:ngl01007]
 Aminotransferase (transaminase)
  Class III
   RG1141_PA08080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pHAMBI1141a:complement(847570..848850)
Genome map
AA seq 426 aa AA seqDB search
MTAITLTERKNAAVSRGVGVTTQIYADRAENSEIWDKQGRRYIDFASGIAVVNTGHRHPR
VIAAVRDQLDRFTHTCHQVVPYETYVRLAERLNELAPGNFAKKTIFVTTGAEAVENAVKI
ARAATSRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHVPFPVELHGVSAE
QSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYAAPAAFLRALREICDQNGILLIADEV
QTGFARTGKMFAMDHHEVAPDLTTMAKGLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGN
PIGIAAAHAVLDVIQDEELCDRANQLGARLKQRLESLRERAPEIVDIRGPGFMNAVEFND
KASKLPSADFANKVRLIALEKGLILLTCGTFGNVIRFLSPITIQDDVFGEALDILEASIL
EASADI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccattacccttacggagcgaaagaatgccgcggtttctcgtggcgtaggcgtg
accacccaaatctatgccgaccgcgcagaaaactccgaaatttgggacaagcaaggccgg
cgctacatcgactttgcatcgggtattgccgtggtgaataccggccatcgtcacccgcgg
gtgatcgcggccgtcagggatcagctggatcgcttcacccacacctgccatcaggtggtt
ccctacgaaacttatgtgcgtctggccgaacggctcaatgagctggcgccaggcaacttc
gccaagaagacgattttcgtgacgaccggcgccgaagccgtcgagaacgcggtaaagatt
gcccgcgctgcgaccagccgctccgccgtcattgcattcggaggcggctttcatggccgt
accttcatgggcatggcgctaacgggcaaggtcgttccttataaggtcggattcggtgcg
atgccgggcgatgtgttccatgtgcccttcccggtcgagctgcatggcgttagcgccgag
cagtcgctggctgcactgaagaagcttttcgctgccgacgtcgacccccaacgcgttgca
gcgatcatcatcgagccggtccagggtgaaggtggtttctatgctgccccggccgcattc
ctgagagcactgcgcgaaatatgtgaccaaaatggcatcttgctgatcgccgacgaggtg
cagacgggttttgcgcgcaccggcaagatgtttgctatggaccaccatgaggtcgcaccc
gacctgacgaccatggccaagggcctcgccggcggcttcccgcttgcagccgtcaccggc
cgcgcggaaatcatggatgcgcccggccccggtggcctgggaggcacttatggcggcaat
ccgatcggcatcgcggcagcccacgcggttctcgacgtcatccaggatgaagagctttgc
gaccgcgccaaccagcttggcgctcgcctgaagcagcggctggaatcactgcgggaaagg
gcgccagaaattgtcgatatccgcggcccgggcttcatgaacgctgtcgaattcaacgat
aaggcgagcaagctaccaagtgccgacttcgcgaacaaggtgcgtctgatcgctctcgaa
aaggggctcatccttctgacgtgcggcacgtttggaaatgttattcgcttcctttcgcct
atcaccattcaggacgacgtcttcggcgaagcactcgacattctcgaagcctccattctt
gaagcaagcgcggatatttag

DBGET integrated database retrieval system