KEGG   Naegleria gruberi: NAEGRDRAFT_59882Help
Entry
NAEGRDRAFT_59882  CDS       T01241                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ngr  Naegleria gruberi
Pathway
ngr00240  Pyrimidine metabolism
ngr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NAEGRDRAFT_59882
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NAEGRDRAFT_59882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-GeneID: 8856273
NCBI-ProteinID: XP_002669717
JGI: Naegr1_59882
LinkDB All DBs
AA seq 275 aa AA seqDB search
MSDIATIEPSATPSTPKKSSPKASCSSTPSNSSKPNGEAINVSTPNSALHLSNQYGFPLN
YNGQIQLIFGNMFAGKTSELLRRLRRYQYAQKETVLVKYINDDRYSKENVSTHDLVQQKA
IPTDRLEKIASQLLGYHVIGIDEGQFFPDLVEFCEAAANGGKIVIVSALDGTFQRKQFGN
VLSLVPMAESVVKLKAVCMVCGKDAAFSKRITDEQQTEVIGGSDKYIATCRKCYMTRNTP
YSKKSKSVFQDSMLEEHEECSDYSEHCEIFSPQKH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattgccactatcgaacctagtgctacaccatccactcctaaaaagtcatca
ccaaaggcttcatgttcttctactccttcaaatagtagtaaaccaaatggtgaagctatc
aatgtttccactccaaattcagcactccacttgtctaatcaatatggttttccattgaat
tataatggtcaaattcaactcatctttggtaatatgtttgctggtaaaacctcggaattg
ttgagaagattacgtagatatcaatatgctcaaaaggaaaccgtattggtaaagtacatc
aatgatgaccgttacagtaaggaaaatgtgtcaacacacgacttggttcaacaaaaagct
attccgacagatcgtctcgaaaagattgcttcacaattgcttggttatcatgttattggt
attgatgaaggtcaattcttccctgatttggttgaattctgtgaagctgctgctaatgga
ggtaaaattgtaattgttagtgctttggatggtactttccaaagaaaacaatttggaaat
gttctttcattggttccaatggctgaaagtgttgtgaaacttaaggctgtttgtatggtt
tgtggtaaagatgctgccttctctaaacgtatcactgatgaacaacaaactgaagttatt
ggtggatctgataagtatattgccacttgtagaaagtgttatatgactagaaatactcca
tattcaaagaagagtaagagcgttttccaagattccatgttagaagaacatgaagaatgc
tctgattattctgaacattgtgaaattttctctcctcaaaaacactaa

DBGET integrated database retrieval system