KEGG   Nocardiopsis gilva: CDO52_24980Help
Entry
CDO52_24980       CDS       T05022                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00473  D-Alanine metabolism
ngv01100  Metabolic pathways
ngv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ngv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDO52_24980 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CDO52_24980 (alr)
Enzymes [BR:ngv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CDO52_24980 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ngv01011]
 Precursor biosynthesis
  Racemase
   CDO52_24980 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASU85620
UniProt: A0A223SC00
LinkDB All DBs
Position
complement(5738594..5739715)
Genome map
AA seq 373 aa AA seqDB search
MPPSFAEARVDLGVISENVAVLRGRAQGAQVMGVVKADGYGHGMIPAARAMLAGGATWLG
TAFIEEALELRGAGIQAPTVSWIIPPGAPLSAGIAADVDLGVSSLWLLDEIATAAQEAGR
RARVHLKADTGLTRGGVTAAEWPDVVAAAARAEAAGLIQVTGVWSHFACADEPGHPSIAS
QINVFHEALEVAEKGGLRPEVRHLANSPATLTLPETHFDLVRTGIASYGINPIPELTFPE
LRPAMTLHTKIALVKRVPEGSGISYGHRYTTTRPSTLALIPLGYGDGIPRAATNLGPVLA
AGRRRTIAGTVCMDQFVLDIGDDAAEAGDDAILFGPGDNGEPTAEDWAAALNTIPYEIVT
RISPRVPRVYVGG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttctttcgccgaagcccgcgtggatctgggcgtgatcagtgagaacgtcgcg
gttctgcgtggccgggcgcaaggtgcgcaggtcatgggcgtggtgaaggccgatggctac
ggacacggaatgatcccggccgcccgcgccatgctggccggtggcgcgacctggctgggc
acggcgttcatcgaggaggccctcgaacttcggggtgcggggatccaggcgcccacggtc
tcgtggatcattccgcccggcgccccgctgtcggcggggatcgccgccgacgtcgacctg
ggcgtgagttcgctgtggctgctcgacgagatcgcgacggcggcgcaggaggccgggcgc
cgggcccgcgtccacctcaaagccgacactgggctcacccgcgggggcgtgaccgccgcc
gagtggcccgacgtcgtggccgccgccgcacgcgccgaggcggccgggctgatccaggtc
accggcgtgtggtcgcacttcgcctgcgcggacgagcccgggcacccctccatcgcctcc
cagatcaacgtgttccacgaggccctggaagtggcggagaagggcggtctgcgccccgag
gtccgacacctggccaactccccggcgacgctcaccctccccgagacccacttcgacctg
gtgcgcaccggcatcgccagctacgggatcaaccccatccccgagctcaccttccccgag
ctgcgcccggccatgactctccacacgaagatcgccctggtcaagagggtgccggagggc
agcggcatctcgtatggacaccgctacaccaccacgcgtccgagtaccctcgccctgatc
ccgctcggctacggcgacggcatcccgcgcgccgcgaccaacctcggcccggtgctggcc
gccgggcgccgccgcacgatcgcggggaccgtctgcatggaccagttcgtcctcgacatc
ggcgacgacgccgccgaggccggtgacgacgccatcctcttcggccccggtgacaacggc
gaacccaccgccgaggactgggcggcggccctgaacacgatcccctacgagatcgtcacg
cgcatcagcccgcgcgtgccgcgcgtctacgtcggcggctag

DBGET integrated database retrieval system