Fusarium vanettenii: NECHADRAFT_39591 Help Entry NECHADRAFT_39591  CDS       T01612                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nhe  Fusarium vanettenii Pathway nhe03010   Ribosome nhe04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nhe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NECHADRAFT_39591   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NECHADRAFT_39591  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nhe03011]     NECHADRAFT_39591    04121 Ubiquitin system [BR:nhe04121]     NECHADRAFT_39591 Ribosome [BR:nhe03011]  Ribosomal proteins   Eukaryotes    Large subunit     NECHADRAFT_39591   Archaea     NECHADRAFT_39591 Ubiquitin system [BR:nhe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NECHADRAFT_39591 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_5 OTU1_UBXL Dsc3_N Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  9672516 NCBI-ProteinID:  XP_003045616 JGI:  39591 UniProt:  C7Z7X8 LinkDB All DBs Position 4 AA seq 89 aa AA seqDB search IQIFVTTMWGPTVTLNTRPSATVGSLYDEIQSRSGLAASEVRLIYGGKALEKDRMLYEYG ISGNETLDSVMRLLGGHTTIGIAETYNFG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atccagatctttgtcacgactatgtggggtccgacggtgacgctcaacacgagaccttct gccacggtggggagtttgtatgatgaaattcagtcgaggagcgggctcgccgccagtgag gtgcgactgatatatggcggcaaagctttggaaaaggaccggatgctctatgagtatgga atctcgggaaatgaaactttggactcggtcatgagattgctcggagggcatacaaccatc gggattgctgagacgtataactttgggtga

DBGET integrated database retrieval system