KEGG   Nectria haematococca: NECHADRAFT_72534Help
Entry
NECHADRAFT_72534  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nhe  Nectria haematococca
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NECHADRAFT_72534
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NECHADRAFT_72534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
10
AA seq 212 aa AA seqDB search
MSVGTYSLPALPYAYDALEPSISAQIMELHHSKHHQAYVNNLNAALKTYASATSSNDIAG
QIALQSAIKFNGGGHINHSLFWENLSPSSSPDSKPDSAPTLVAEISKTWGSLEAFQETFK
KTLLGLQGSGWGWLVKDTQGLRIVTTKDQDPVVGGEVPIFGVDMWEHAYYLQYLNGKAAY
VDNIWNVINWKTSEARFVGTREDAFKVLRASI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttggaacctactctctcccggcgctgccgtacgcctacgatgcccttgagcct
agcatctcggcccagatcatggagctccaccacagcaagcaccaccaggcctacgtcaac
aacctcaacgctgctctcaagacatacgcctcggctacatcgtccaacgatattgcaggc
cagatcgccctccagtcagctatcaagttcaacggaggcggccacatcaaccactctctc
ttctgggagaacctgagcccctccagctccccagactccaagcccgacagcgcccccacc
ctggtcgccgagatctccaagacctggggcagcctcgaggccttccaggagaccttcaag
aagaccctgctgggtctgcagggaagtggctggggatggttggtcaaggatactcagggc
ctgcgcatcgtcaccacaaaggaccaggatcccgtcgttgggggtgaggtgcccatcttt
ggcgttgacatgtgggagcatgcctactacctgcagtacctcaacggcaaggctgcctac
gtcgacaacatttggaacgtcattaactggaagacatctgaggcacgattcgtcggtacc
cgggaggatgctttcaaggttctgcgggcttccatttga

DBGET integrated database retrieval system