KEGG   Niabella ginsenosidivorans: A8C56_20450Help
Entry
A8C56_20450       CDS       T04418                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
nia  Niabella ginsenosidivorans
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nia00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    A8C56_20450
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A8C56_20450
Enzymes [BR:nia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     A8C56_20450
Bacterial toxins [BR:nia02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   A8C56_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4822767..4824329)
Genome map
AA seq 520 aa AA seqDB search
MNKIKSLLTAARLAVLFFIPAISNAQGTKADAEVLNYRIPVFKRVDENPVQRVRIFIPGG
SLTAKQLVINTDAASASLIDKIRIFNTRNEPVFSGKGIPVNIQPVAGKNAIPINDTLAPG
LNYLWVSVLLKEQAPVDKKVQLSTHTIILSNGSSLPIRAGNQLEKGWYTGIRIRKPGDDS
VNTYRIPGIVRTDKNTLIAVYDVRYKNDRDLPADIDIGMSRSTDNGETWEPMKIIMSMGK
PGENSGIGDPAVLFDPAGKKIWVAGLWSKGNRSIAGSEPGLSPDVSGQFVLVCSADDGKT
WSAPINITSQVKNPAWHLYFQGPGNGIAMQNGTLVFASQYWDETKKPGIPHGSVIYSMDH
GKTWKSGIGAKSNTTESQVIETTPGTLMLNMRDNRGGFRSVATTKDMGKTWLEHPTSYEA
LPDPVCMASIIKASVKIKGVLREVVFFSNMNNSDARKHLTIKASLDLGATWLPAHQLLID
ERKAYGYSALVQVDEETLGVLYEGIRDLNFVKIPVADIIN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataaaatcgttgcttaccgctgcccgcctggctgttcttttttttataccg
gcaataagtaacgcacagggaacaaaagcggatgctgaagtgctcaactataggatccct
gtgttcaaaagggtagatgaaaaccccgttcaacgggtcaggatttttattcccggcgga
tcattaacagcaaagcaactggtcataaacacagacgcggcaagtgcctccctgatcgat
aagatccgtatttttaacacccgcaatgaaccggtgttttccggtaaaggcataccggtt
aacatacagcctgttgcaggaaaaaatgctattcctatcaacgacacactggcgccggga
ctcaattacctgtgggtaagtgttcttttaaaagagcaggcacctgttgataagaaggtt
cagctaagcacacatacaattattctatcaaatggcagcagcctgcccatcagggccggt
aatcagttagagaaggggtggtacaccggcatcaggatccgcaaaccgggtgatgactcc
gttaatacctaccggattcccggtattgtaagaaccgacaaaaatacactgatcgctgtt
tatgacgtacggtataaaaatgacagggatcttcctgctgatattgatataggtatgagc
cgcagcactgataacggcgaaacctgggaacccatgaagatcattatgagtatgggtaaa
cccggggagaacagcggcattggtgatcccgccgttttgtttgatccggccggtaaaaaa
atatgggtagccgggttatggagcaaaggtaaccggtccattgccggatctgagcctggt
ttgtcaccggatgtttcggggcagtttgttttagtctgcagtgctgatgacggaaaaacc
tggtctgcgccgatcaatattacttcgcaggtaaaaaatcctgcctggcatttatatttt
caggggcccggcaacggcatcgccatgcaaaacggaacgcttgttttcgcatcccagtac
tgggatgaaacaaagaagcccggcattccacacggatcagtcatttacagtatggatcat
ggaaaaacctggaaatccggcattggcgctaaatcaaataccacagaaagccaggtaata
gaaaccacgccgggaaccctgatgctgaacatgcgggataaccggggtggttttcgcagc
gttgctaccacaaaagatatgggtaaaacatggctggagcatccaacttcttacgaagca
ctgccagaccctgtttgcatggcatccatcattaaggcaagcgtaaagataaaaggtgta
ttgagggaagtggttttctttagtaacatgaataatagtgacgcgcgcaagcatttaacc
attaaagcgagccttgatttgggcgcaacctggctgccggctcaccagctactgattgat
gagcggaaggcttatggctactctgcattggtgcaggtggatgaagagacccttggagtt
ttatatgaagggataagagacctgaattttgtaaaaatccctgtagcggatattataaac
tga

DBGET integrated database retrieval system