KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05785Help
Entry
NKOR_05785        CDS       T02304                                 

Definition
(GenBank) ATP-dependent DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr03030  DNA replication
nkr03410  Base excision repair
nkr03420  Nucleotide excision repair
nkr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NKOR_05785
   03410 Base excision repair
    NKOR_05785
   03420 Nucleotide excision repair
    NKOR_05785
   03430 Mismatch repair
    NKOR_05785
Enzymes [BR:nkr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NKOR_05785
    6.5.1.6  DNA ligase (ATP or NAD+)
     NKOR_05785
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NKOR_05785
DNA replication proteins [BR:nkr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NKOR_05785
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NKOR_05785
DNA repair and recombination proteins [BR:nkr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NKOR_05785
   NER (nucleotide excision repair)
    Other NER factors
     NKOR_05785
   MMR (mismatch exicision repair)
    Other MMR factors
     NKOR_05785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AFS81040
UniProt: K0B7V9
LinkDB All DBs
Position
966401..968167
Genome map
AA seq 588 aa AA seqDB search
MEFSVLADAFNKMESTRKRLELTQYLVELFEKTPQDVISKIVYLLQGKLRPDFEGIELGI
AEKLAIRAISKSSGIPVKKIEDEYRKSGDLGHAATIILEQKTQTTFLVEDITVERVYETL
FKIAKSEGNRSQDMKMKYISSLLNDASPLEASFILKILLGTLRLGIAENTVMDALAMAFS
GNKENRKVLEHAYNVSSDLGKVAEILAKEGLEEVEKLKIILFNPIRPMLADRVKSEQEAI
EKMGESFAAEYKLDGERVQLHVEGDKVVLFSRSLENISSYYPDIIEKIPKTIQAENIILE
AEAVAINENTGEFLPFQELMHRRRKYKIEKAVTQYPITVNLFDILYCNGKSCLELAYKER
REKLEKVVKEDDFVKHIPMAIVKNENDIEDFFENSINAGSEGLMLKMLDKPYQAGSRGSH
WLKLKREYQNELGDSLDLVVIGGFFGKGRRTGSYGTLLLATYEEDEDTFTSICKVGTGFS
DEDLDQLYQILNPKVTIKKNPRIDSEMEADVWFEPELVIEVVASEITLSPIHKAARDKVR
KGAGLALRFPKFTGKIRVEKMAEDASTNEEVITLYQGQKKVAHDKSLM
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggagttttctgtgttagctgatgcatttaacaagatggaatcaactagaaaaagatta
gagctaactcagtatctggtagaattatttgaaaagacaccacaagatgtgatttcaaag
atagtttatcttcttcaaggaaagttaagaccagattttgaagggattgaattagggatt
gcagaaaaacttgcgatacgagcaatctcaaaatcttcaggaattcctgttaaaaaaatt
gaagatgagtacaggaaaagcggagacttgggacatgctgcaaccataatactagaacaa
aaaacgcaaacaacatttcttgtagaagacattacagtagaacgagtttacgaaacatta
ttcaaaattgcaaagtcagaaggaaacagatcacaggacatgaagatgaaatacatttct
agtctactaaatgatgcaagtccgttagaagcaagtttcatcctaaaaattttgttagga
acactcagactaggtattgcagaaaatacagtaatggatgcattggcaatggcgttttca
ggaaacaaagaaaacagaaaagtcctagaacatgcatacaatgtttctagcgacttggga
aaagtcgcagagattttagcaaaagaaggattagaagaagttgaaaaactcaagataatt
ttgtttaatccaatcagaccaatgcttgcagacagagtaaagagcgaacaagaagcaatt
gaaaaaatgggagaatcatttgcagcagaatacaagttagatggagaaagagttcagtta
catgttgaaggggacaaggttgttttgttttcaagaagtctagaaaacatttcaagttac
tatccagacattatagaaaaaattccaaaaacaattcaggcagagaacataatactagaa
gcagaagcagttgcaatcaatgaaaacacgggagagtttttaccatttcaggaattaatg
catagaagaagaaaatacaagatagaaaaagcagttacccaatatccaatcacagttaat
ctgtttgatattttgtattgcaatggaaaaagctgtttagagttagcctacaaagaaaga
agagaaaaacttgaaaaagttgtgaaagaagatgattttgtaaaacacattccaatggca
atagtaaaaaatgaaaatgacattgaagacttttttgaaaacagcataaacgctggaagt
gaaggcttgatgctaaagatgctggataaaccataccaagcaggttctcgtggaagtcat
tggctaaaactcaaaagagaatatcaaaatgaactgggagacagtttagatcttgtagta
ataggaggtttctttggaaaaggaagaagaactgggagctatggaactttgttgttagca
acatatgaggaagacgaggatacattcacaagtatttgtaaagttgggacaggattttca
gatgaagatttagatcaattgtatcaaatcctaaatcccaaagtcacaatcaagaaaaac
ccacgcattgatagcgagatggaagctgatgtgtggtttgagccagaattagtaatagaa
gtagttgcatctgaaattacactcagtccaatccacaaagcagcaagagacaaagtcaga
aaaggtgcaggacttgcgttgagattcccaaagtttactggaaagataagagttgaaaaa
atggcagaagacgcatctacaaatgaagaagtaattacgttataccaaggtcagaaaaaa
gtggcacatgacaaaagtctcatgtaa

DBGET integrated database retrieval system