KEGG   Natrialba magadii: Nmag_3076Help
Entry
Nmag_3076         CDS       T01176                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nmg  Natrialba magadii
Pathway
nmg00564  Glycerophospholipid metabolism
nmg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nmag_3076
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Nmag_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_3 FAD_binding_2 FAD_oxidored NAD_binding_7 Pyr_redox GMC_oxred_N 3HCDH_N ApbA NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADD06628
UniProt: D3SR72
LinkDB All DBs
Position
complement(3179266..3180492)
Genome map
AA seq 408 aa AA seqDB search
MPITTDVLVIGGGATGTGIARDLTLRGVDVTLAERGGLSAGTTGRSHGLLHSGARYAEAD
AEGALECLEENQILREIAGECIRETRGLFVQVAGDDSAYFDEKRAACEELGIPVEVVDGD
DAREAVSGLAAAVERAMWVPDAVVLPSRLVAATAADAREHGARILTHAPVESMVLEGERI
DSVSLGGAAETVVEPEFVVNATGPHAGAVAAMAGVTVEMRPTRGVMVSVDHDGLEPVLNR
CRDPADGDIIVPHDDEVVLGTTSVPVDDLDEFERDQQEVERTIRECATMLPAVADAPQVR
TWWGIRPLYEPDEAARGGRGISRGFVQLDHAEDGVANFVSIVGGKLTTYRRMAESVSDLV
ADRLGVGNSSTTAGRELIGASSASELDAFVDEFDGRGPTDADLVDQDG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcacaaccgacgtcctcgtcatcggcggcggcgcaaccggaactggaatcgcc
cgcgacctcacccttcgcggcgtcgacgtcacactcgccgaacgcggcggcctctcggcc
ggcaccaccgggcgctcacacggcctccttcacagcggcgcccgctacgccgaagccgac
gccgagggtgcactcgagtgcctcgaggagaaccaaatcctgcgggagattgcgggcgag
tgcatccgagagactcgcggtctcttcgtgcaagtggccggcgacgactcggcgtacttc
gacgagaaacgtgcggcctgcgaggaactgggcattccggtcgaagtcgtcgacggcgac
gacgcgcgggaggcggtgtccggactcgccgcagctgtcgaacgcgcgatgtgggtgccg
gacgccgtcgtcctcccctcgcggctggtcgcggctactgccgccgacgctcgcgaacac
ggcgctcgcattctgacacacgcaccggtggaatcgatggtactcgagggcgagcgcatc
gactcggtttcgctcggcggcgcagcagagaccgtcgtcgaacccgaattcgttgtcaac
gcgacggggccacacgccggcgcggtcgcagcaatggcgggcgtgacagtggaaatgcgc
ccgacgcgaggcgtgatggtttcggtcgaccacgacggcctcgaaccggtgctcaatcgc
tgtcgggatccagcggacggcgatatcatcgttccgcacgacgacgaggtcgtgctcggg
acgacgagcgtgccggtcgacgatctcgacgagttcgagcgcgaccagcaggaagtcgag
cggacgatccgcgagtgtgcgacgatgctccccgccgtggccgacgccccacaggttcgg
acgtggtggggcatccgcccgctgtacgaacccgacgaggcggctcgcggcggccgcggt
atctcgcgcgggttcgttcaactcgatcacgccgaggacggcgtcgccaacttcgtcagt
atcgtcggcggcaaactcaccacgtaccggcggatggccgagtccgtttccgatctggtt
gcggatcggcttggggtggggaactcgagtacgacggccgggcgagaactgatcggtgcc
tcgtcggcgagcgaactcgatgcgttcgtcgacgagttcgatggccgtgggccgacggat
gctgatctggtcgatcaggatgggtga

DBGET integrated database retrieval system