KEGG   Nitrosospira multiformis: Nmul_A0685Help
Entry
Nmul_A0685        CDS       T00302                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00630  Glyoxylate and dicarboxylate metabolism
nmu01100  Metabolic pathways
nmu01120  Microbial metabolism in diverse environments
nmu01200  Carbon metabolism
Module
nmu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmul_A0685
Enzymes [BR:nmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nmul_A0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABB73992
JGI: NmulA0685
UniProt: Q2YB79
LinkDB All DBs
Position
complement(786731..787165)
Genome map
AA seq 144 aa AA seqDB search
MMTNFQNRLTQGQFSFLPPLTDKQISAQIKYALKNNWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILQEINDCRKTYPNHYIRVTAFDSSRGVESPAMSYIVNRPKNEPGFGLVRQ
EVDGRQIRYTVHSYATEKPEAERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaattttcaaaaccgtctcacgcaagggcaattttcttttctgcccccgctg
acggataagcagatttcggcgcaaatcaaatatgcgctgaagaacaactgggctatcgga
attgaatataccgatgatccgcatccccgcaacacgtattgggaaatgttcggcaacccg
atgttcgacctgaaggaccccgcgggtatcctgcaggagatcaacgattgccgcaagacc
tatccgaaccactacattcgtgttacggctttcgattcatcgcgcggtgtggaaagcccg
gcgatgtcctacatcgtcaaccgtccgaagaacgagcctggttttggcttggtgcgtcag
gaagtggatggacggcaaattcgctataccgtccattcctacgcaacggaaaaaccggaa
gcagagcggtactga

DBGET integrated database retrieval system