Nestor notabilis (Kea): 104412858 Help Entry 104412858         CDS       T08494                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism nnt  Nestor notabilis (Kea) Pathway nnt04010   MAPK signaling pathway nnt04012   ErbB signaling pathway nnt04068   FoxO signaling pathway nnt04137   Mitophagy - animal nnt04140   Autophagy - animal nnt04144   Endocytosis nnt04150   mTOR signaling pathway nnt04210   Apoptosis nnt04218   Cellular senescence nnt04370   VEGF signaling pathway nnt04371   Apelin signaling pathway nnt04510   Focal adhesion nnt04540   Gap junction nnt04625   C-type lectin receptor signaling pathway nnt04810   Regulation of actin cytoskeleton nnt04910   Insulin signaling pathway nnt04912   GnRH signaling pathway nnt04916   Melanogenesis nnt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nnt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104412858 (HRAS)    04012 ErbB signaling pathway     104412858 (HRAS)    04370 VEGF signaling pathway     104412858 (HRAS)    04371 Apelin signaling pathway     104412858 (HRAS)    04068 FoxO signaling pathway     104412858 (HRAS)    04150 mTOR signaling pathway     104412858 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104412858 (HRAS)    04140 Autophagy - animal     104412858 (HRAS)    04137 Mitophagy - animal     104412858 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104412858 (HRAS)    04218 Cellular senescence     104412858 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104412858 (HRAS)    04540 Gap junction     104412858 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104412858 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104412858 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104412858 (HRAS)    04912 GnRH signaling pathway     104412858 (HRAS)    04916 Melanogenesis     104412858 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104412858 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnt04131]     104412858 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nnt04147]     104412858 (HRAS)    04031 GTP-binding proteins [BR:nnt04031]     104412858 (HRAS) Membrane trafficking [BR:nnt04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104412858 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104412858 (HRAS) Exosome [BR:nnt04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104412858 (HRAS)   Exosomal proteins of colorectal cancer cells    104412858 (HRAS) GTP-binding proteins [BR:nnt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104412858 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  104412858 NCBI-ProteinID:  XP_010021986 UniProt:  A0A091RR60 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggtggtggtgggagctggtggtgttgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgatcccacgatagaggattcctac agaaagcaagtcgtcattgatggagagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgaggacgggggaaggattcctctgc gtgtttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgacctc ccagcacggacagtggaaacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system