KEGG   Nostoc sp. PCC 7524: Nos7524_1120Help
Entry
Nos7524_1120      CDS       T02363                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nos7524_1120
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nos7524_1120
Enzymes [BR:nop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nos7524_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1290272..1291702
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQSKAGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQFIAYIAYPLDLFEEGSVTNMFTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVADAIHKSQAETGEIKGHY
LNVTAPTCEEMLKRAEYAKELGMPIIMHDYLTAGFTANTTLARWCRDNGLLLHIHRAMHA
VIDRQKNHGIHFRVLAKALRMSGGDHIHTGTVVGKLEGDRAITMGFVDLLRENYVEQDKS
RGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLAREGNDVIREAAKWSPELAAACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagtcaaaagctgggtatcaagccggggttaaagat
tacagactaacttattacacaccagattacacacctaaagatacagatattctggcggca
ttccgtgttacacctcagcccggagttcctcctgaagaagcaggtgcggctgtagcggct
gagtcttccactggtacttggacaactgtgtggaccgacttgttgaccgatctagatcgc
tacaaaggtcgttgctacgacatcgaaccagttcccggcgaagacaaccaatttattgcc
tacattgcctatcctctggatctgtttgaagaaggttctgtaaccaatatgtttacctcc
atcgtaggtaacgtattcggttttaaagcattgcgggcgttacgtctagaagacttacgc
attcccgttgcttacctgaagaccttccaaggtcctccccacggtattcaagttgagcgt
gacaaattaaacaaatacggtcgtcctttgttgggttgtaccattaaacccaaattaggt
ttgtctgctaaaaactacggtcgtgcagtatacgaatgtttgcgcggtggtttggacttc
accaaagacgacgaaaacattaactccgcacctttccaacgttggcgcgatcgcttcttg
ttcgtagctgatgctatccacaaatctcaagcagaaaccggcgaaatcaaaggtcactac
ctaaacgtcaccgctcctacctgcgaagaaatgttgaagcgggctgagtacgctaaagaa
ctcggtatgcccatcatcatgcacgactacctaaccgcaggtttcaccgctaacaccacc
ttggctcgttggtgtcgtgacaacggtttgttactgcacatccaccgcgcgatgcacgct
gtaatcgaccgtcaaaagaaccacggtatccacttccgtgtattggctaaagcactacgt
atgtctggtggtgatcacatccacaccggtacagttgtaggtaaattggaaggcgatcgc
gccatcacaatgggcttcgtcgatttgttgcgtgaaaactacgttgagcaagacaagtct
cgcggtatctacttcacccaagactgggcttccatgcctggtgtaatggcagttgcttcc
ggtggtatccacgtatggcatatgcccgcactggtagaaatcttcggtgacgactccgta
ctgcaattcggtggtggtacactcggacacccctggggtaacgctcctggtgcaaccgct
aaccgtgtggctctggaagcttgtatccaagctcgtaacgaaggccgtaacttggctcgt
gaaggtaacgacgttatccgtgaagctgctaagtggtctcctgaattggctgctgcttgc
gaactgtggaaagaaatcaagttcgagtttgaggcaatggataccgtctga

DBGET integrated database retrieval system