KEGG   Nostoc sp. PCC 7524: Nos7524_1122Help
Entry
Nos7524_1122      CDS       T02363                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nos7524_1122
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nos7524_1122
Enzymes [BR:nop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nos7524_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1292372..1292701
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQIAKQVQYILNQGYIPAIEFNETSEPTEFYWTMWKLPL
FGAKSTQEVLGEVQACRSQYGNCYIRVVGFDNIKQCQVLSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccaaaagagcgtcgttacgaaaccctgtcttacctgcctcccctcagc
gacgcgcaaattgccaagcaagtccaatacattctcaatcaagggtacattcctgcgatc
gaattcaacgaaacctctgaacccaccgaattttattggacaatgtggaagctacctttg
tttggtgctaaatccactcaagaagttttgggtgaagttcaagcttgccgttcccagtac
ggtaactgctacatccgtgttgtaggtttcgacaacatcaaacagtgccaagttctcagc
tttatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system