KEGG   Nostoc sp. PCC 7524: Nos7524_2549Help
Entry
Nos7524_2549      CDS       T02363                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nos7524_2549
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nos7524_2549
   00680 Methane metabolism
    Nos7524_2549
Enzymes [BR:nop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Nos7524_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3102714..3105791)
Genome map
AA seq 1025 aa AA seqDB search
MSSVLYSLSESANLYPASELFLRRRLQIVEELWESVLRQECGQNMVDLLRQLRDLCSPEG
QATKDQATSAVKLIEQLNINEAIRAARGFALYFQLINIIEQEYEQKQQLTRYSEVEQELA
HQENSHNINYSSNQNEDDFTLNGAGGMDWLTKNGSSREQNRQRGTFAALFPLLHKLNVPP
QQIQRLISQLDVRLVFTAHPTEIVRHTIRDKQRQVVKLLQQLDAVETGANNGSGYPWEAG
ELREKLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRFKYSLGKTF
PWLEPPSTDFCSFGSWVGSDRDGNPSVTPEVSWQTACYQRKMVLERYIKSVKQLIELLSI
SMHWSDVLPDLLESLELDQSQLSEVYDALALRYRQEPYRLKLSYVLKRLENTRDRNLALY
KGETPTNEDSPMYRSGAEFLAELRLIQRNLTETGLSCRELDNLICQVEIFDFHLTQLDIR
QESSRHSDALNEILEYLQILPQPYNELSEEQRVEWLTSELQTRRPLISSELPFSDKTNDV
IKTFRVVRSLQQEFGVNICKTYIISMCRQVSDVLEVLLLAKEARLFDPAIAVGTIHVVPL
FETVEDLQRSRSIMRQLFELPLYRALLAGGYAVLNGSQETLPPSPHLPLPTEAFSLTPDL
QEVMLGYSDSNKDSGFLSSNWEIHKAQKSLQKIAEEYGVKLRIFHGRGGSVGRGGGPAHE
AILAQPGHSINGRIKITEQGEVLASKYSLLDLALYNLETITTAVIQASLLRTGFDDIEPW
NEIMEELAARSRQHYRALIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSL
RAIPWVFSWTQTRFLLPSWYGVGTALQEFLGEEAEEHLKLLRYFYVKWPFFKMVISKAEM
TLAKVDMQMARHYVQELSNPEDKARFEKVFEQIASEFYLTRDLVLKITDHHRLLDGDPVL
QRSVQLRNGTIVPLGFIQVSLLKRLRQSKNIATSGVIHSRYSKGELLRGALLTINGIAAG
MRNTG
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgttttatactctctatctgaatctgccaatctataccccgcctcagaatta
tttttgcgccgtcgtctgcaaatcgtagaagaattgtgggagtccgtactccggcaagaa
tgcgggcagaatatggtggatctattgcggcagttgcgtgacttgtgttcaccagaagga
caagcgacaaaagatcaagccacttctgctgtcaaattgattgaacagttaaatattaac
gaagcgatcagagcagcacggggttttgctttgtattttcagctgatcaacatcatagag
caggaatacgaacaaaagcagcaattaactcgctactcggaagtagaacaagaattagcc
catcaggaaaattctcacaatattaactattcctccaaccaaaatgaagatgatttcacc
ttaaatggtgctggaggcatggattggctaacaaaaaatggttcttctagagaacaaaat
agacaaagaggcacattcgccgctctatttcccctattacataagttgaatgtcccaccc
caacagattcaacgcttgatttcccagttggacgtgcgtttggtatttacagcccacccg
acggaaattgtccgccacaccatccgcgataaacaacggcaggtagtcaaattgctgcaa
caactcgatgctgtggaaactggcgctaataatggtagcggctacccttgggaagcagga
gaactacgggaaaaactattagaagaaattcgcctctggtggcgcactgatgaactgcac
cagtttaagcctacggttttggatgaagtagattatgccttgcactacttccaagaagta
ttatttgatggtatccctcaactgtataaacgcttcaaatactccttggggaaaacattt
ccttggctagaaccaccaagtacagatttttgttcctttggttcttgggtaggttcagat
agggatggaaatccatctgtcaccccggaagtgagctggcagacagcctgctatcagcgc
aaaatggtgctagagagatatatcaagtcagtcaaacaattgattgaattactgagtatt
tctatgcactggagtgatgttttaccagatttgctggagtctctggagttagatcaatcc
cagttaagtgaagtttacgacgcactagcgttaagatatcgccaagaaccctatcgcctc
aagctatcttatgtcctgaagcggttggaaaatacccgcgatcgcaatttagctttgtat
aagggcgaaactcccaccaatgaagatagccctatgtaccgttctggtgcagagtttttg
gcggaactgcgcttgattcagcgtaacttgacggaaaccggattaagttgtcgagagtta
gataatctcatctgtcaagtcgaaatttttgactttcatctcacccagctagacatccgc
caagaatcttcccgacactcagatgctttaaacgagattctggaatacctacaaattctg
ccccaaccttacaacgaactctcggaagagcagcgcgttgaatggttaaccagtgaactc
caaacccgccgccccttaatctcatcagagttgccattttctgataagactaatgatgtc
attaaaaccttccgggtagtgcgatcgctacagcaagaatttggcgtgaacatctgcaaa
acctacatcattagtatgtgtcgtcaggtaagcgatgtcctggaagtgttgctattagcc
aaggaagccagattatttgatccggcgatcgcggtcggcacaattcacgttgtaccatta
tttgaaacagtcgaagacttgcaacgttcccgcagcatcatgcggcaactgtttgaactt
cctttatatcgtgccttgttagcaggtggttacgccgtactcaacggtagccaagaaacc
ctacctccctcgccccatctccccctccccaccgaggcgttttctctcacccctgactta
caggaggtaatgctggggtattctgacagtaacaaagattctggtttcttaagtagtaac
tgggaaattcacaaagcccaaaaatccttgcaaaagatagctgaagaatacggcgttaag
ctccgcatttttcatggacgcggcggttctgtaggacgaggaggcggccctgcccacgaa
gcaattttggcacaaccaggccatagtatcaacggccgcatcaagattacggaacaaggg
gaagtgttagcttccaaatactccttactagatttggctttatacaacctggaaaccatc
accacggcagtaattcaagccagcttgttacggacagggtttgatgacatcgaaccttgg
aacgagattatggaagaattggcagcgcgatcgcggcaacattatcgtgctttaatttac
gaacagccggattttattgattttttccaccaagtcaccccaattgaagaaatcagccag
ctacaaattagttctcgtcccgcccgtcgtccctctggcaaaaaagatttaagcagtctc
cgcgctatcccctgggtatttagttggacacaaacccgctttttgctaccttcttggtac
ggtgtaggtacagctttacaagaatttttgggtgaagaagcagaagaacacctaaaatta
ctccgctacttttacgttaagtggccgttcttcaaaatggtcatttccaaagcggaaatg
acactggcaaaggtagatatgcaaatggcacgccattacgtccaagaattatctaaccca
gaagacaaagcccggtttgaaaaagtgtttgagcaaattgccagtgaattctaccttact
agggatttagttctcaaaattaccgatcatcatcggttattagatggcgatcccgtgcta
caacgttctgtacagttacgcaacggtacaatcgtcccccttggttttatccaagtttcc
ctcctcaagcgcctgcgccaatccaaaaatattgccacctccggcgtaattcattcgcgt
tacagcaaaggcgagttactcagaggcgcactattaaccattaacggtattgccgcaggg
atgagaaatacaggttga

DBGET integrated database retrieval system