KEGG   Neofusicoccum parvum: UCRNP2_4705Help
Entry
UCRNP2_4705       CDS       T03126                                 

Definition
(RefSeq) putative hexokinase protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
npa  Neofusicoccum parvum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCRNP2_4705
   00051 Fructose and mannose metabolism
    UCRNP2_4705
   00052 Galactose metabolism
    UCRNP2_4705
   00500 Starch and sucrose metabolism
    UCRNP2_4705
   00520 Amino sugar and nucleotide sugar metabolism
    UCRNP2_4705
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UCRNP2_4705
Enzymes [BR:npa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UCRNP2_4705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 492 aa AA seqDB search
MVGLGPRKPPSRKGSMADVPKDLLATIKRLEELFTVPADKLKEISDHFVTELEKGLSKEG
GSIPMIPTWCMGFPTGDEQGTFLALDMGGTNLRVCEVSLTEEKGEFDIIQSKYRMPQELK
TGTAEELWEYVADCLQQFVEYHHEGEDLKQLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGKDVVPPFEAALKERGVPIKLTALVNDTTGTLIASAYTDPRMKIGCIFGTGCNAAY
MEDCGSIPKLEHMKLPPNELMGINCEWGAFDNEHKVLPRTKYDIIIDKESPRPGQQSFEK
MIAGLYLGEVFRLVVLDLHEDPHCHLFEGQDVSKLKKPYTMDSSFLATIEEDPFENLQET
ADLFQNTLGLVLKKPELELCRRLAELIGTRAARLSACGVAAICKKKGWTECHVGADGSVF
NKYPHFKARGAQALREIFGWPKGKRDPIEIVPAEDGSGVGAALIAALTLKRVKEGNHAGI
RDPKGLLEGLNP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtctcggtcccaggaagccaccgtcccgcaagggttctatggccgatgtgcct
aaggatctccttgcgactatcaaacgcctcgaggagctcttcaccgtgcccgccgacaag
ctcaaggagatcagcgaccactttgtcaccgagctggagaagggcctgtccaaggagggc
ggcagcattcctatgattcccacctggtgcatgggcttccccaccggtgatgagcagggc
acgttcctcgccctggacatgggcggcaccaacctccgtgtttgcgaggtctccttgacc
gaggagaagggagagttcgacatcatccagtccaagtacaggatgccccaggagctgaag
acgggcaccgccgaggagctgtgggagtacgttgccgactgcctgcagcagttcgtcgag
taccaccacgagggcgaagacctcaagcagctcccgctgggtttcaccttctcctacccc
gccacccaggactacatcgaccacggtgttctgcagaggtggaccaagggcttcgacatc
gatggtgtcgagggcaaggatgtcgtcccgcctttcgaggctgcgcttaaggagaggggc
gttccgatcaagctcactgcgcttgtcaacgataccaccggtacccttattgcctcggcc
tacaccgacccgcgcatgaagattggatgcattttcggcactggctgcaacgccgcgtac
atggaggactgcggttccatccccaagctcgagcacatgaagctcccccctaatgaactc
atgggcatcaactgcgagtggggcgcttttgacaacgagcacaaggttctgcccaggacc
aagtatgacatcatcatcgacaaggagtctccccgccctggtcagcagtcgttcgagaag
atgattgctggtctctacctaggagaggtcttccgcctggtcgtccttgacctccacgag
gacccgcactgccacctgtttgagggccaggatgtgagcaagctcaagaagccctacacc
atggactcttcgttcctggctactattgaggaggatccgttcgagaacttgcaggagact
gccgacctcttccagaacacgctcggcctggtcctcaagaagcccgagctcgagctgtgc
cgtcgcctggccgagctgatcggcacccgtgccgctcgcctctcggcctgtggtgtcgct
gccatctgcaagaagaagggctggactgagtgccacgtcggcgctgacggctccgtcttc
aacaagtacccgcacttcaaggctcgcggcgcccaggccctccgcgagatctttggttgg
cccaagggcaagcgtgaccctattgagatcgtccccgctgaagacggttctggtgtcggt
gccgccctcatcgctgccctcaccctcaagcgcgtcaaggagggcaaccacgccggtatc
cgcgaccccaagggtctgctcgagggcctcaacccgtaa

DBGET integrated database retrieval system