KEGG   Neofusicoccum parvum: UCRNP2_7300Help
Entry
UCRNP2_7300       CDS       T03126                                 

Definition
(RefSeq) putative glutathione s-transferase protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
npa  Neofusicoccum parvum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:npa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UCRNP2_7300
Enzymes [BR:npa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     UCRNP2_7300
Transporters [BR:npa02000]
 Other Transporters
  Pores ion channels [TC:1]
   UCRNP2_7300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MSSTKPIVLYSHATGPNPWKVAIILEELQIPYETKFLDFPAMKQEPYESVNPNGRVPAIE
DPNTGIKLFESGAIIEYLVDTYDKTNALHSDTAPEKYLEKSWLHFQMSGQGPYYGQKAWF
TYFHPEKGITSAIDRYANEIKRVVGVIDRHLQKTGKPYLVGDKISYADLAFVPWHMALGF
LVPDFDFAKEFPTFSKWNQSLMDRPAVKKIAADKAAASQK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccaagcccatcgtcctctactcgcacgccacgggccccaacccgtggaag
gtcgccatcatcctcgaggagctgcagatcccctacgagaccaagttcctcgacttcccg
gcgatgaagcaggagccgtacgagtcggtcaaccccaacggccgcgtgcccgccatcgag
gaccccaacaccggcatcaagctgttcgagtccggcgccatcatcgagtacctggtcgac
acctacgacaagaccaacgccctccactccgacaccgcccccgagaagtacctggagaag
tcgtggctgcacttccagatgtccggccagggcccctactacggccagaaggcctggttc
acctacttccacccggagaagggcatcacctccgccatcgaccgctacgccaacgagatc
aagcgcgtcgtcggcgtcatcgaccgccacctgcagaagacggggaaaccctacctcgtc
ggcgacaagatctcgtacgccgacctggccttcgtgccctggcacatggccctcggcttc
ctggtgcccgacttcgacttcgccaaggagttccccaccttctccaagtggaaccagagc
ttgatggacaggccggccgtgaagaagattgccgccgacaaggccgccgcctcgcagaag
tga

DBGET integrated database retrieval system