KEGG   Neofusicoccum parvum: UCRNP2_7417Help
Entry
UCRNP2_7417       CDS       T03126                                 

Definition
(RefSeq) putative dna ligase 4 protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
npa  Neofusicoccum parvum
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:npa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    UCRNP2_7417
Enzymes [BR:npa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UCRNP2_7417
DNA repair and recombination proteins [BR:npa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     UCRNP2_7417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1025 aa AA seqDB search
MAGASVMQSQEAVDEEKRQYGHGSMTEEELDEKYPNRPHNHSKTLPFHTLYLDLFNPLND
NKKKPTGPPTARRRQGPHGQAHMTPNEIRRNIIERFISRWRQEVGSDIYPAFRLIVPEKD
RDRAMYGLKEKAIGKLLVRVLRIDKDSEDGFNLLNWKLPGQKATVAMAGDFAGRCFDVIS
KRPILTKPGNMTIAEVNERLDKLSVVSKEEDQLPIFQEFYQRMNAEEMMWLIRVILRQMK
VGATERTIFSIWHPDAESLFNVSSSLRRVCWELYDPSIRLDGDETGVNLMQCFQPQLAAF
QMHSFEKMVQRMKPTEDDDEFWIEEKLDGERMQLHMIEDESVPGGKRFGFWSRKAKDYTY
LYGSSFEDDDSALTRHLKEAFHSGVRNIILDGEMITWDMEQDAMVPFGTLKTAALSEQKN
PYSTGQRPLYKIFDLLYLNDEPLTKYTLRDRRKALDTSIHPVHRRFEIHTYTTANSPGEI
EPLLRKVVSEASEGLVIKNPRSMYRLNQRNDDWIKVKPEYMTEFGEELDCVIVGGYYGSG
HRGGRLSSFLCGLRVDQNQIERGANPMKCFSFFKVGGGMTAADYAAIRHNTNDKWQKWDP
KRPPTEYIELAGGDRQYERPDVWIKPCDSVVVSVKAASVGTTEQFRMGMTLRFPRFKKLR
ADKSWKDALSIQDFLTLKSNAEQAHAEKEFKVDDGRRKRQRTTRKRPMTVAGFDDASRSP
TAADDASSRPQVFAGLTFYIMTDALAPKTPKPDLEALVKAHGGRLVHSPTAAPHVVCVAD
RRLVPVASLVKKNERSVVRPAWLLDCVAQAAADAALGRATDDGVPPLLLPYEGRRHLFHA
TDDDAVQADGAVDAWGDSFARDVASGAELKRDVLDRMAVPPVKAEEENDDVVVGARFLDQ
MEERDVPLFGDGEVSGWLFRGARVWFDDDDDDDDDDAGSPAAAATRLYLAAQVVRFAGGA
VAAGLGEEGVTQVVVAPGVRKERLREIREAVAAKGGPVPRVVSVEWVEESWKERTLLDEE
RFVAL
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcctccgtgatgcagagccaggaggccgttgacgaggagaagcgccagtac
ggccacggctccatgaccgaggaagagctggacgagaagtatcccaatcgcccgcacaac
cactcgaagacactgccctttcacactctctacctcgacctcttcaatcccctcaatgac
aacaagaagaagcccaccggcccgcccactgcccgcaggagacagggcccccatggccag
gctcacatgactcccaatgaaatccgccgcaacatcatcgaacgcttcatctcgagatgg
cgccaggaggtcggcagcgacatctacccggccttccgcctgatcgtccccgagaaggac
cgcgatcgcgccatgtacggcctcaaggagaaggccattggcaagctacttgtacgcgtt
ctccgtatcgacaaggactcggaggacggcttcaacctgctcaactggaagcttcccggc
cagaaagccaccgtggccatggctggcgactttgctggcaggtgctttgacgtcatttcc
aagcggcccattctgaccaagccgggaaacatgaccatcgctgaagtgaacgaacgactg
gacaagctctctgtcgtctccaaggaggaggaccagcttcctatcttccaggagttctac
cagcgcatgaatgcagaggagatgatgtggctgatccgcgtcattctccgccaaatgaaa
gtgggagccaccgagaggactattttcagcatctggcaccccgatgctgagagtctgttc
aacgtttcatccagcttacgcagagtgtgctgggagctgtacgatccatccatccgctta
gatggggacgagaccggggtgaatctcatgcagtgcttccagccgcagctggcagccttc
cagatgcattcgttcgagaaaatggtccaacgaatgaagccaacagaagatgacgacgaa
ttttggatcgaggaaaagctcgacggcgagcgcatgcaactgcacatgattgaggatgaa
agtgtgcctggcggcaagcgctttggattctggtcccgcaaagccaaagactacacctac
ctgtacgggagcagctttgaggatgatgatagcgccctcacgcgacatctgaaggaggct
ttccatagcggagtgcgcaacatcatactcgacggcgagatgatcacttgggatatggaa
caagacgccatggtcccgttcggcacactgaagacagctgcgctctctgagcaaaagaat
ccttactcaactggccaacgccctctctacaagatttttgatctcctctaccttaatgat
gaaccccttactaagtacacgctccgtgaccgcagaaaggcgctggataccagtatccac
cccgtccaccgccggtttgagattcacacatacaccacagccaacagcccaggggaaatc
gagccgctccttcgcaaagtcgtatccgaagcgtccgaaggcttggtcatcaagaaccca
cgctccatgtaccggctgaaccagcgcaacgacgactggatcaaagtcaagcccgagtac
atgaccgagttcggcgaggagctcgactgcgtgatcgtcggaggctactacggatccggg
caccggggcgggcggctttccagcttcctgtgcgggctgcgcgtcgaccagaaccagatc
gagcgcggcgcgaacccgatgaagtgcttctcgttcttcaaggtcggcggcggcatgacg
gcggcggactatgcagccatccggcacaacacgaacgacaagtggcagaaatgggacccc
aagcggccgccgaccgagtacatcgagctcgccggcggcgacaggcagtacgagcggccg
gacgtgtggatcaagccgtgcgactcggtcgtcgtgtccgtcaaggcggcatccgtcggg
acgaccgagcagttccgcatgggcatgacgctgcgcttcccgcgcttcaagaagctccgc
gccgacaagagctggaaagacgcactctcgatccaagacttcctgacgctcaagagcaac
gcggagcaggcccacgcggagaaggagttcaaagtcgatgacgggcggcgcaagcggcag
cgcaccacgcgcaaacgccccatgacggtcgccggcttcgacgacgccagccgctccccc
accgccgccgacgacgcctcctcccgcccccaggtcttcgccggcctgaccttctacatc
atgacggacgcgctcgcccccaaaacgcccaagcccgacctcgaagccctggtcaaggcg
cacggcgggcgcctcgtgcactcccccacggccgcgccccacgtcgtgtgcgtcgccgac
cggcgcctcgtgccggtcgcgtcgctggtcaagaagaacgagcgctccgtcgtgcgcccg
gcctggctgctcgactgcgtcgcgcaggcggccgccgacgccgcgctggggcgggcgacc
gacgacggcgtgccgccgctgctgctgccctacgagggccgccgccacctcttccacgcc
accgacgacgacgccgtgcaagccgacggcgccgtcgacgcctggggcgacagcttcgcc
cgcgacgtcgcgtccggcgccgagctgaagcgcgacgtcctggatcggatggccgtgccg
ccggtcaaggcggaggaggagaacgacgacgtcgtcgtcggcgcgaggtttttggaccag
atggaggagcgcgatgtgccgctgttcggcgacggcgaggtcagcgggtggctgttcagg
ggggcgagggtgtggttcgacgacgacgacgacgacgacgacgacgacgcgggctcgccg
gcggcagcggcgacgaggctgtatctcgcggcgcaggtggtgcggtttgcgggaggggcg
gtggcggcggggttgggggaggagggcgtgacgcaggtcgttgtggcgccgggggtgagg
aaggagaggttgcgggagatcagggaggcggtggcggcgaagggcgggccggtgccgagg
gtggtgagtgtagaatgggtggaggagagctggaaggagaggaccctgttggatgaggag
aggtttgttgcgttgtga

DBGET integrated database retrieval system