KEGG   Novosphingobium sp. PP1Y: PP1Y_AT16965Help
Entry
PP1Y_AT16965      CDS       T01515                                 

Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  
elongation factor Tu
Organism
npp  Novosphingobium sp. PP1Y
Brite
Translation factors [BR:npp03012]
 Eukaryotic Type
  Elongation factors
   PP1Y_AT16965
 Prokaryotic Type
   PP1Y_AT16965
Mitochondrial biogenesis [BR:npp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PP1Y_AT16965
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PP1Y_AT16965
  Exosomal proteins of breast cancer cells
   PP1Y_AT16965
  Exosomal proteins of colorectal cancer cells
   PP1Y_AT16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1787797..1788987
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLSETFGGEAVDFANIDKAPEERERG
ITISTAHVEYETDQRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHI
LLARQVGVPALVVFMNKVDQVDDEELLELVELEVRELLSSYDFPGDDIPIIKGSALAALE
GRDDAIGKEKILELMKAVDEYIPQPPRPTDKPFLMPVEDVFSISGRGTVVTGRVETGIIK
VGEEVEVIGIRDTQKTTVTGVEMFRKLLDQGEAGDNIGALVRGLKRDDVERGQVLAKPGT
VTPHTEFSAEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNVT
LSVKLIAPIAMDEGLRFAIREGGRTVGSGVVATITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcaaaatttgagcggaacaagccgcactgcaacattggcaccatcggccac
gtcgaccacggcaagaccacgctgactgccgcgatcaccaaggttctttcggaaactttc
ggcggtgaagcagtcgacttcgccaacatcgacaaggctcccgaagagcgcgagcgcggc
atcaccatctcgaccgcacacgtcgagtacgagaccgaccagcgtcactacgcccacgtc
gactgcccgggtcacgctgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgcgatcctcgtcgtgaacgctgccgacggcccgatgccccagacccgtgagcacatc
ctgctcgcccgtcaggtcggcgttccggctctcgtcgtgttcatgaacaaggtcgaccag
gtcgacgacgaagagctcctcgagctcgtcgaactcgaagttcgcgaactgctgtcctcg
tacgacttcccgggcgacgatattccgatcatcaagggctcggctctggccgctctcgaa
ggccgcgacgacgccatcggcaaggaaaagatcctcgagctcatgaaggccgtggacgag
tacatcccgcagccgccgcgcccgaccgacaagcccttcctgatgcccgtcgaagacgtg
ttctcgatctcgggccgtggtacggttgttaccggccgcgtcgaaaccggcatcatcaag
gtcggtgaagaagtcgaagtcatcggtatccgcgacacgcagaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgaccagggcgaagccggcgacaacatcggcgcgctg
gttcgtggcctgaagcgcgacgacgtggagcgtggccaggttctcgccaagccgggcacc
gtgaccccgcacaccgagttctcggctgaggtctacgtcctgtcgaaggacgaaggcggc
cgtcacacgccgttcttcgcgaactaccgtccgcagttctacttccgcaccaccgacgtc
accggcgaagtgatccttcccgagggcaccgagatggtgatgccgggcgacaacgtgacc
ctgtcggtcaagctcatcgctccgatcgccatggacgaaggtctgcgcttcgctatccgc
gaaggcggccgcaccgtcggctcgggcgttgttgccacgatcacgaagtaa

DBGET integrated database retrieval system