KEGG   Nanorana parkeri: 108785994Help
Entry
108785994         CDS       T04897                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
npr  Nanorana parkeri
Brite
Enzymes [BR:npr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108785994 (ACE)
Peptidases [BR:npr01002]
 Metallo Peptidases
  Family M2
   108785994 (ACE)
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108785994 (ACE)
CD molecules [BR:npr04090]
 Proteins
  108785994 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1287 aa AA seqDB search
MVWTLLLGLLLVGSTLALDSSYLPGSYGTTEAEAQRFVGDFNSTAELIFFKSVEASWTYN
TNLTEYNSQLQVEASLEEQEFNEIWGEKAKELFTTSYQNFTDTQLKKIIDSIWTLGASNL
NITDRTEYNIILSDMDRIYSTAKVCPPGQTTDCWSLEPELTEIMATSRSYKKLLYAWEGW
HNSAGKPLRSKYEQFVRLSNKAYSLDGFTDTGAYWRSWYTSSTFENDLEELYHQLEPLYL
NLHAFVRRKLYERYGEKYINLQGPIPAHLLGNMWSQTWNNIYDMMIPFPDKTNVDVTSTM
REKGWNATYMFQVSEEFFTSLGLLEMPPEFWQKSMLEKPADGREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTFRRGANPGFHEAIGDVLSLSVSTPG
HLKTIGLLSDVTEDPESDINYLLKMALEKIAFLPFGYLIDQWRWNVFNGRTPASRYNYDW
WNLRTKYQGICPPLPRNDVEFDPGAKFHIPGNTPYIRYFVSFVLQFQFHKTLCAAAKHTG
PLHRCDIYRSKEAGTILGNVLRSGSSRTWQEVLKDMAGTDKMDVGPLLEYFEPVTNWLKE
QNAKTNETLGWTDFSWRPPLPDGYPGDIDKNANERQAQDFLGEYNTTAEQVWNDYTEASW
AYNTNITEHNNQVMLDKNLAMSSHTLQYGRQARNFDYSDFQSPEVKRLLKKLSDIDKAAL
SEAEQKEYNQIVSEMETIYSKATVCKDGKCMPLDPDLTALLAKSRDYDELLWAWKGWRDS
SGKKMRNLYKRYVELGNKAAVLNDHADNGAYWRSWYETPTLESDVERLYHELQPLYLNLH
AYVRRALYKKYGDKKINLKGPLPAHLLGNMWAQSWSNIFDLVVPYPNAAQVDATPAMVAQ
KWTAKKMFEESDRFFTSLGLLPMPPEFWEKSMIEKPADRDVVCHASAWDFYNRKDFRIKQ
CTVVTMDDLITVHHEMGHVEYFLQYKDKPVSFREGANPGFHEAIGDVLALSVSTPKHLNS
IGLLDKVEDNKESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRTPDSEYNQQWWNLR
LKYQGLCPPVLRSEDDFDPGAKFHIPANVPYIRYFISFVIQFQFHEALCNAAKQTGPLHT
CDIYQSLEAGKLLGDAMKLGYSKPWPDVMEVITGQRNMSANALLKYFEPLTNWLIEQNQN
NKETLGWPEYNWSPVLNEATSATPATPTTPSKVDFLGMKLDNGQAAAGAWVLLALGIVLV
LTTIFLGVKFSKVKRKTKKSTSELELK
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atggtctggactctcctcctagggctgctccttgtgggtagcactctagccctggacagc
agctacctgccgggtagctatggaacaaccgaagcggaggcacagcgatttgtcggcgac
ttcaacagcacagcggagctgatctttttcaagagcgtggaagccagctggacctacaac
accaacctaacggaatacaactctcagctccaggttgaggcctccctagaagagcaggag
ttcaatgagatatggggggaaaaagccaaggaacttttcactacttcatatcaaaacttc
actgatacacagctcaagaaaatcattgattctatctggaccttgggtgcttctaatctg
aacattacagatcgtacagagtataatattattctcagcgacatggacagaatctattca
acagccaaagtgtgccctcccggccaaactacggactgctggtctctggaaccagagctt
actgagatcatggcaacttcacgcagctacaagaagttactgtatgcctgggaaggctgg
cataactctgctggaaaaccactacggagcaaatatgaacaatttgtaaggctcagtaac
aaggcttacagcttggatggattcacagacaccggagcatactggcgctcttggtacacc
tcatccacttttgagaatgacctggaggagctttatcatcaactggagcccctgtatctc
aatctccatgcctttgtccgcagaaaactctatgaaagatatggagaaaaatacataaac
ctccaaggcccaattcctgcacacctattaggtaacatgtggtcgcaaacgtggaataat
atctatgatatgatgattcccttccctgacaagactaatgtggatgtaaccagcactatg
agggaaaagggttggaacgccacctacatgtttcaggtctcagaagaattcttcacctct
ctgggtctgctagagatgccaccagaattctggcagaagtctatgctggagaagcctgca
gatggtcgggaggtggtgtgtcatgcctctgcatgggacttctacaacagaaaagacttc
aggatcaagcagtgtactacggttaccatggagcaattgttcactgtccaccatgagatg
ggacatgtggagtattacctgcagtataaagaccagccagtcacattccgcagaggtgct
aatccaggtttccatgaagctataggggatgtgctgtctctatctgtatccactccagga
catctgaaaactattggcttgctcagtgacgtcacagaagatccagagagcgatattaat
tacctccttaagatggctttggagaaaattgccttcttgccttttggctacttgattgac
cagtggaggtggaatgttttcaatggacggactcctgccagtcgatacaactacgactgg
tggaatctcaggactaagtatcaaggaatatgccctcctttgccaagaaatgatgttgaa
tttgatcctggtgcaaaattccacattccaggcaacaccccatacatcagatactttgtg
agctttgtactgcagttccagttccacaagacactatgcgcagcagccaaacacacaggc
cccctacatagatgtgacatttaccgatccaaagaagctggcacaatcctgggtaatgtc
ctacgttcaggttcttctaggacttggcaggaagttctgaaagacatggctggaacagac
aaaatggacgttgggccactgttggaatattttgagccagtgactaactggttgaaagag
cagaacgctaaaacaaatgaaactcttggttggacagatttttcctggagaccacctttg
cctgatggatatcctggagacattgataaaaatgctaatgagaggcaggcacaagatttc
ttaggcgagtacaacactacagcagagcaggtgtggaatgattatactgaggcgtcatgg
gcttataacaccaacatcacagaacacaacaaccaagtcatgctggacaaaaacctagca
atgtccagtcacactctacagtatggaagacaggccagaaactttgactacagtgatttc
cagagtccagaggtaaagcgactattgaagaagctcagtgatattgataaagcagctctg
tcagaagccgagcagaaagagtacaatcaaattgtttctgaaatggaaaccatctacagc
aaggcaacagtatgcaaagatggcaaatgcatgcctctggatccagatctgactgcactt
cttgccaagtcgcgtgactatgatgaactgctgtgggcatggaaaggttggcgagattct
tctggcaaaaaaatgcgcaacctctacaagagatatgtagagctgggtaacaaggcagca
gtacttaatgatcatgcagataatggtgcatactggaggtcatggtatgagacaccaact
ttggaaagtgatgttgagaggctttatcatgagctgcagcctctttatctcaacctgcac
gcttatgtacgccgggccctctacaagaaatatggagacaagaaaatcaaccttaaagga
ccccttcctgcccatctgcttggtaacatgtgggcccagtcatggtccaatatatttgat
cttgttgttccatatcctaatgcagcacaagtggatgccacaccagcaatggtggctcag
aaatggaccgcaaaaaagatgtttgaggaatcagacagattctttacctctctaggactc
cttcctatgcctccagaattctgggaaaaatccatgattgagaaacctgctgacagagat
gtggtttgccatgcatctgcttgggacttctacaaccgaaaagatttcagaatcaagcaa
tgcacagtagtcaccatggatgaccttatcactgtccaccatgaaatgggtcatgttgag
tacttcctgcagtacaaagataaaccagtttccttcagagaaggagccaaccctggcttt
catgaggctatcggagatgtattagccctgtctgtttctactcctaagcatctcaacagc
attgggcttctggacaaagttgaggacaataaagagagtgacatcaactatcttatgagt
attgcactggataaaatagccttcctaccctttggatacctgatggaccaatggcgttgg
aaagtgtttgatggaagaactccagattcagaatataaccagcagtggtggaatctaaga
ctgaaatatcaggggttgtgtcctccagtcttgaggtctgaagatgattttgaccctggg
gcaaaattccacattcctgccaatgtcccatacatcaggtatttcatcagcttcgtcatt
cagttccagttccacgaggctttgtgtaatgcagccaaacagactgggcccctccacacc
tgtgatatttatcaatccttggaggctggaaagttgcttggagatgccatgaagttgggt
tacagcaagccttggccggacgtgatggaagttattactggacagagaaatatgtccgct
aatgccctccttaaatactttgagcctttgaccaactggctaattgagcaaaatcaaaac
aataaagaaacccttggctggccagaatacaactggagtccagttcttaatgaagccaca
tcagccacaccagccacaccaaccacaccatcaaaagtcgacttcttaggaatgaaattg
gacaacgggcaagcggcagcaggagcctgggtcctcttagctcttggaatagttctggtc
ctcacaaccattttcttaggtgtcaagttctcaaaagtaaaacgtaagacgaagaaatcc
acctctgaactggaactgaaataa

DBGET integrated database retrieval system