KEGG   Nostoc punctiforme: Npun_F4197Help
Entry
Npun_F4197        CDS       T00713                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, small chain RbcS
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
npu  Nostoc punctiforme
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Npun_F4197
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_F4197
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Npun_F4197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
5265663..5265992
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQIAKQIQYILNQGYIPAIEFNETSEPTELYWTMWKLPL
FGAKSTQEVLSEVQGCRSQFNGSYIRVVGFDNIKQCQVLSFLVHKPNRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccaaaagagcgtcgttacgaaaccctttcttatctgccacccctgtct
gacgctcaaattgccaagcagattcagtacattttgaatcaaggttacattccagcgatc
gagttcaacgaaacttctgagccaacagaattatattggacaatgtggaagttgcctttg
ttcggtgctaaatccactcaagaagtattgagcgaagttcaaggatgccgttctcaattt
aacggtagctacattcgtgttgtaggttttgataacatcaagcagtgccaagttctcagc
tttcttgttcacaaacccaacagatactaa

DBGET integrated database retrieval system